PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT4G18890.1
Common NameBEH3, F13C5_60
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family BES1
Protein Properties Length: 284aa    MW: 30907.6 Da    PI: 8.4041
Description BES1/BZR1 homolog 3
Gene Model
Gene Model ID Type Source Coding Sequence
AT4G18890.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
       DUF822   1 ggsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpleeaeaagssasaspesslqssl 98 
                  ++++r+ptwkErEnnkrRERrRRaiaaki+aGLR +Gn+klpk++DnneVlkALc+eAGw+vedDGttyrkg+kp+++++ ++ s+sasp+ss+q   
                  5899*******************************************************************************************... PP

       DUF822  99 kssalaspvesysaspksssfpspssldsislasaasllpvlsvlslv 146
                       +sp++sy++sp+sssfpsp++    +  +a+sl+p+l++ls+ 
                  .....*******************98....56677899****999763 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056872.4E-603132IPR008540BES1/BZR1 plant transcription factor, N-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009025anatomyvascular leaf
PO:0009052anatomyflower pedicel
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 284 aa     Download sequence    Send to blast
3D Structure ? help Back to Top
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5zd4_A6e-24677372443Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1
5zd4_B6e-24677372443Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1
5zd4_C6e-24677372443Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1
5zd4_D6e-24677372443Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.328590.0seed| silique
Expression -- Microarray ? help Back to Top
Source ID E-value
Expression AtlasAT4G18890-
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
Motif logo
Cis-element ? help Back to Top
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
Regulation -- Hormone ? help Back to Top
Source Hormone
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT4G18890
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1188500.0AK118850.1 Arabidopsis thaliana At4g18890 mRNA for unknown protein, complete cds, clone: RAFL21-18-A16.
GenBankAY0883790.0AY088379.1 Arabidopsis thaliana clone 6321 mRNA, complete sequence.
GenBankBT0245120.0BT024512.1 Arabidopsis thaliana At4g18890 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_193624.10.0BES1/BZR1 homolog 3
SwissprotO494040.0BEH3_ARATH; BES1/BZR1 homolog protein 3
TrEMBLQ2HIR90.0Q2HIR9_ARATH; At4g18890
STRINGAT4G18890.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP15951542
Publications ? help Back to Top
  1. Seki M, et al.
    Functional annotation of a full-length Arabidopsis cDNA collection.
    Science, 2002. 296(5565): p. 141-5
  2. Wang ZY, et al.
    Nuclear-localized BZR1 mediates brassinosteroid-induced growth and feedback suppression of brassinosteroid biosynthesis.
    Dev. Cell, 2002. 2(4): p. 505-13
  3. Yin Y, et al.
    A new class of transcription factors mediates brassinosteroid-regulated gene expression in Arabidopsis.
    Cell, 2005. 120(2): p. 249-59
  4. Wang Y, et al.
    Strigolactone/MAX2-induced degradation of brassinosteroid transcriptional effector BES1 regulates shoot branching.
    Dev. Cell, 2013. 27(6): p. 681-8