PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT4G18020.5
Common NameAPRR2, PRR2, T6K21.200, TOC2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family ARR-B
Protein Properties Length: 487aa    MW: 54250.1 Da    PI: 5.7244
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT4G18020.5genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like81.97.2e-26297350256
      G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                  ++++WtpeLH++Fv+aveqL G ++A+P++ilelmkv  Lt+++v+SHLQk+R +
  AT4G18020.5 297 KKVDWTPELHKKFVQAVEQL-GVDQAIPSRILELMKVGTLTRHNVASHLQKFRQH 350
                  689*****************.********************************76 PP

2Response_reg33.13e-123913314109
                   HHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTT.SEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTTESEEEESS--HHHH CS
  Response_reg  14 lrqalekegyeevaeaddgeealellkekd..pDlillDiempg.mdGlellkeireeepklpiivvtahgeeedalealkaGakdflsKpfdpeel 107
                    r+ le+ +y +v++++d +eal  + ++   +++ ++ ++m+  +   e +k ++++++ lp i++++    +++ +++ +Ga +fl Kp +pe+l
   AT4G18020.5  39 TRSELESMDY-IVTTFTDETEALSAVVKNPesFHIAIVEVNMSAeS---ESFKFLEAAKDVLPTIMISTDHCITTTMKCIALGAVEFLQKPLSPEKL 131
                   5778999***.**************9666667**********9945...556666677789***********************************9 PP

                   HH CS
  Response_reg 108 vk 109
                    +
   AT4G18020.5 132 KN 133
                   86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011024.43325139IPR001789Signal transduction response regulator, receiver domain
PfamPF000728.1E-937133IPR001789Signal transduction response regulator, receiver domain
SuperFamilySSF521729.25E-1337141IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23005.5E-1439166No hitNo description
CDDcd001561.71E-843138No hitNo description
PROSITE profilePS5129416.667293352IPR017930Myb domain
Gene3DG3DSA:1.10.10.609.7E-25294352IPR009057Homeodomain-like
SuperFamilySSF466897.17E-19295353IPR009057Homeodomain-like
TIGRFAMsTIGR015571.1E-23297350IPR006447Myb domain, plants
PfamPF002496.3E-8299347IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007623Biological Processcircadian rhythm
GO:0005634Cellular Componentnucleus
GO:0000156Molecular Functionphosphorelay response regulator activity
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005515Molecular Functionprotein binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020100anatomyhypocotyl
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 487 aa     Download sequence    Send to blast
MVITANDLSK WENFPKGLKV LLLLNGCDSD GDGSSAAETR SELESMDYIV TTFTDETEAL  60
SAVVKNPESF HIAIVEVNMS AESESFKFLE AAKDVLPTIM ISTDHCITTT MKCIALGAVE  120
FLQKPLSPEK LKNIWQHVVH KAFNDGGSNV SISLKPVKES VVSMLHLETD MTIEEKDPAP  180
STPQLKQDSR LLDGDCQENI NFSMENVNSS TEKDNMEDHQ DIGESKSVDT TNRKLDDDKV  240
VVKEERGDSE KEEEGETGDL ISEKTDSVDI HKKEDETKPI NKSSGIKNVS GNKTSRKKVD  300
WTPELHKKFV QAVEQLGVDQ AIPSRILELM KVGTLTRHNV ASHLQKFRQH RKNILPKDDH  360
NHRWIQSREN HRPNQRNYNV FQQQHRPVMA YPVWGLPGVY PPGAIPPLWP PPLQSIGQPP  420
PWHWKPPYPT VSGNAWGCPV GPPVTGSYIT PSNTTAGGFQ YPNGAETGFK IMPASQPVSV  480
NNSLFSF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A4e-15296354563ARR10-B
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.253940.0floral meristem| flower
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible254704_at0.0
Expression AtlasAT4G18020-
AtGenExpressAT4G18020-
ATTED-IIAT4G18020-
Functional Description ? help Back to Top
Source Description
TAIREncodes pseudo-response regulator 2 (APRR2) that interacts with a calcium sensor (CML9).
UniProtTranscriptional activator that binds specifically to the DNA sequence 5'-[AG]GATT-3'. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT4G18020.5
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Interaction ? help Back to Top
Source Intact With
BioGRIDAT5G51910
IntActSearch Q6LA43
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT4G18020
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0415310.0AB041531.1 Arabidopsis thaliana APRR2 mRNA for pseudo-response regulator 2, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001078405.10.0CheY-like two-component responsive regulator family protein
RefseqNP_001154250.10.0CheY-like two-component responsive regulator family protein
RefseqNP_001329339.10.0CheY-like two-component responsive regulator family protein
RefseqNP_001329340.10.0CheY-like two-component responsive regulator family protein
RefseqNP_001329342.10.0CheY-like two-component responsive regulator family protein
RefseqNP_001329343.10.0CheY-like two-component responsive regulator family protein
SwissprotQ6LA430.0APRR2_ARATH; Two-component response regulator-like APRR2
TrEMBLA0A178V2250.0A0A178V225_ARATH; PRR2
STRINGAT4G18020.60.0(Arabidopsis thaliana)
Publications ? help Back to Top
  1. Makino S, et al.
    Genes encoding pseudo-response regulators: insight into His-to-Asp phosphorelay and circadian rhythm in Arabidopsis thaliana.
    Plant Cell Physiol., 2000. 41(6): p. 791-803
    [PMID:10945350]
  2. Matsushika A,Makino S,Kojima M,Mizuno T
    Circadian waves of expression of the APRR1/TOC1 family of pseudo-response regulators in Arabidopsis thaliana: insight into the plant circadian clock.
    Plant Cell Physiol., 2000. 41(9): p. 1002-12
    [PMID:11100772]
  3. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  4. Hwang I,Sheen J
    Two-component circuitry in Arabidopsis cytokinin signal transduction.
    Nature, 2001. 413(6854): p. 383-9
    [PMID:11574878]
  5. Hwang I,Chen HC,Sheen J
    Two-component signal transduction pathways in Arabidopsis.
    Plant Physiol., 2002. 129(2): p. 500-15
    [PMID:12068096]
  6. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  7. Brenner WG,Romanov GA,K
    Immediate-early and delayed cytokinin response genes of Arabidopsis thaliana identified by genome-wide expression profiling reveal novel cytokinin-sensitive processes and suggest cytokinin action through transcriptional cascades.
    Plant J., 2005. 44(2): p. 314-33
    [PMID:16212609]
  8. Lee BH,Henderson DA,Zhu JK
    The Arabidopsis cold-responsive transcriptome and its regulation by ICE1.
    Plant Cell, 2005. 17(11): p. 3155-75
    [PMID:16214899]
  9. Pischke MS,Huttlin EL,Hegeman AD,Sussman MR
    A transcriptome-based characterization of habituation in plant tissue culture.
    Plant Physiol., 2006. 140(4): p. 1255-78
    [PMID:16489130]
  10. Thibaud-Nissen F, et al.
    Development of Arabidopsis whole-genome microarrays and their application to the discovery of binding sites for the TGA2 transcription factor in salicylic acid-treated plants.
    Plant J., 2006. 47(1): p. 152-62
    [PMID:16824183]
  11. Vaughn MW, et al.
    Epigenetic natural variation in Arabidopsis thaliana.
    PLoS Biol., 2007. 5(7): p. e174
    [PMID:17579518]
  12. Perochon A, et al.
    Interaction of a plant pseudo-response regulator with a calmodulin-like protein.
    Biochem. Biophys. Res. Commun., 2010. 398(4): p. 747-51
    [PMID:20627089]
  13. Arabidopsis Interactome Mapping Consortium
    Evidence for network evolution in an Arabidopsis interactome map.
    Science, 2011. 333(6042): p. 601-7
    [PMID:21798944]
  14. Gong L, et al.
    Transcriptome Profiling of the Potato (Solanum tuberosum L.) Plant under Drought Stress and Water-Stimulus Conditions.
    PLoS ONE, 2015. 10(5): p. e0128041
    [PMID:26010543]