PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT4G17980.1
Common Nameanac071, NAC071
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family NAC
Protein Properties Length: 262aa    MW: 30122.1 Da    PI: 8.3752
Description NAC domain containing protein 71
Gene Model
Gene Model ID Type Source Coding Sequence
AT4G17980.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM168.91.7e-5261351128
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk. 95 
                  lppGfrFhPtdeel+ +yL +k+eg ++el evi+ +d+yk++Pw+Lp k  + +++ ew+fF++rdkkya+g+r+nratk+gyWkatgkd+++++k 
  AT4G17980.1   6 LPPGFRFHPTDEELIGYYLSRKIEGLEIEL-EVIPVIDLYKFDPWELPgKsFLPNRDLEWFFFCPRDKKYANGSRTNRATKAGYWKATGKDRKITCKs 102
                  79****************************.99***************6434455677**************************************94 PP

          NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrl 128
                  ++   g +ktLvfy+grap g +t+W+mheyrl
  AT4G17980.1 103 SHVIAGYRKTLVFYEGRAPLGDRTNWFMHEYRL 135
                  45558**************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.01E-593160IPR003441NAC domain
PROSITE profilePS5100557.7126160IPR003441NAC domain
PfamPF023655.6E-297135IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007275Biological Processmulticellular organism development
GO:0008283Biological Processcell proliferation
GO:0071365Biological Processcellular response to auxin stimulus
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 262 aa     Download sequence    Send to blast
MGSSCLPPGF RFHPTDEELI GYYLSRKIEG LEIELEVIPV IDLYKFDPWE LPGKSFLPNR  60
DLEWFFFCPR DKKYANGSRT NRATKAGYWK ATGKDRKITC KSSHVIAGYR KTLVFYEGRA  120
PLGDRTNWFM HEYRLCDIDD HSQKSPNFKG AFALCRVVKK NELKKNSKSL KNKNEQDIGS  180
CYSSLATSPC RDEASQIQSF KPSSTTNDSS SIWISPDFIL DSSKDYPQIK EVASECFPNY  240
HFPVTTANHH VEFPLQEMLV RS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swp_D2e-50616120169NAC domain-containing protein 19
3swp_C2e-50616120169NAC domain-containing protein 19
3swp_B2e-50616120169NAC domain-containing protein 19
3swp_A2e-50616120169NAC domain-containing protein 19
3swm_D2e-50616120169NAC domain-containing protein 19
3swm_C2e-50616120169NAC domain-containing protein 19
3swm_B2e-50616120169NAC domain-containing protein 19
3swm_A2e-50616120169NAC domain-containing protein 19
4dul_B2e-50616117166NAC domain-containing protein 19
4dul_A2e-50616117166NAC domain-containing protein 19
1ut7_B2e-50616117166NO APICAL MERISTEM PROTEIN
1ut7_A2e-50616117166NO APICAL MERISTEM PROTEIN
1ut4_B2e-50616117166NO APICAL MERISTEM PROTEIN
1ut4_A2e-50616117166NO APICAL MERISTEM PROTEIN
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.329550.0cell culture
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO184150010.0
Genevisible254698_at0.0
Expression AtlasAT4G17980-
AtGenExpressAT4G17980-
ATTED-IIAT4G17980-
Function -- GeneRIF ? help Back to Top
  1. Data show that two plant-specific transcription factor genes, ANAC071 (At4g17980) and RAP2.6L (At5g13330) were abundantly expressed.
    [PMID: 21911380]
  2. XTH20 and XTH19 are regulated by auxin via ANAC071 in the distal part of an incised stem and are involved in cell proliferation in the tissue reunion process.ANAC071 bound to the XTH20 and XTH19 promoters to induce their expression.
    [PMID: 25182467]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00439DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT4G17980.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT4G17980
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0026871e-162CP002687.1 Arabidopsis thaliana chromosome 4 sequence.
GenBankAL1615471e-162AL161547.2 Arabidopsis thaliana DNA chromosome 4, contig fragment No. 47.
GenBankAL0218891e-162AL021889.2 Arabidopsis thaliana DNA chromosome 4, BAC clone T6K21 (ESSA project).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_193532.10.0NAC domain containing protein 71
SwissprotQ9FFI57e-69NAC86_ARATH; NAC domain-containing protein 86
TrEMBLO496970.0O49697_ARATH; NAC domain containing protein 71
STRINGAT4G17980.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1715800
MalvidsOGEM21512777
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Menges M,Hennig L,Gruissem W,Murray JA
    Cell cycle-regulated gene expression in Arabidopsis.
    J. Biol. Chem., 2002. 277(44): p. 41987-2002
    [PMID:12169696]
  3. Ooka H, et al.
    Comprehensive analysis of NAC family genes in Oryza sativa and Arabidopsis thaliana.
    DNA Res., 2003. 10(6): p. 239-47
    [PMID:15029955]
  4. Scheible WR, et al.
    Genome-wide reprogramming of primary and secondary metabolism, protein synthesis, cellular growth processes, and the regulatory infrastructure of Arabidopsis in response to nitrogen.
    Plant Physiol., 2004. 136(1): p. 2483-99
    [PMID:15375205]
  5. Che P,Lall S,Howell SH
    Developmental steps in acquiring competence for shoot development in Arabidopsis tissue culture.
    Planta, 2007. 226(5): p. 1183-94
    [PMID:17581762]
  6. Barakat A,Wall PK,Diloreto S,Depamphilis CW,Carlson JE
    Conservation and divergence of microRNAs in Populus.
    BMC Genomics, 2007. 8: p. 481
    [PMID:18166134]
  7. Asahina M, et al.
    Spatially selective hormonal control of RAP2.6L and ANAC071 transcription factors involved in tissue reunion in Arabidopsis.
    Proc. Natl. Acad. Sci. U.S.A., 2011. 108(38): p. 16128-32
    [PMID:21911380]
  8. Pitaksaringkarn W, et al.
    XTH20 and XTH19 regulated by ANAC071 under auxin flow are involved in cell proliferation in incised Arabidopsis inflorescence stems.
    Plant J., 2014. 80(4): p. 604-14
    [PMID:25182467]