PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT4G17695.1
Common NameFCAALL, KAN3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family G2-like
Protein Properties Length: 322aa    MW: 36922.9 Da    PI: 8.8058
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT4G17695.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like100.41.2e-31165218255
      G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                  pr+rWt++LH++Fv+av+ LGG+e+AtPk++lelm+v++Ltl+hvkSHLQ+YR+
  AT4G17695.1 165 PRMRWTTTLHAHFVHAVQLLGGHERATPKSVLELMDVQDLTLAHVKSHLQMYRT 218
                  9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466895.02E-15162219IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.1E-27163219IPR009057Homeodomain-like
TIGRFAMsTIGR015573.0E-23165219IPR006447Myb domain, plants
PfamPF002499.8E-7166217IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007275Biological Processmulticellular organism development
GO:0030154Biological Processcell differentiation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 322 aa     Download sequence    Send to blast
MELFPSQPDL YLKISRRREE EQEKESQELQ EQEVERRLGF QSKASDLDNK SSNNLIHTLQ  60
FTSNNEATKI NSNQEHKESL DQDLRSIFMM RPIRGIPLYQ NQVLDHYYYS STSPNPFFFS  120
EVNGQHASRR LITNPNCSFN LHNRHRRQAQ PQPPRFTAKR GVRAPRMRWT TTLHAHFVHA  180
VQLLGGHERA TPKSVLELMD VQDLTLAHVK SHLQMYRTIK STEKPTTSSG QSDCENGSQV  240
NSEREARNLT GLWNNSSSEA RFQLKAKASS GVDISSNENE WKNRRCPSNE RLSSDSSSLT  300
GTRPETETPN LDFTLATPNL SP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A3e-16166220458Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B3e-16166220458Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A3e-16166220357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B3e-16166220357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C3e-16166220357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D3e-16166220357Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A3e-16166220458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C3e-16166220458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D3e-16166220458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F3e-16166220458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H3e-16166220458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J3e-16166220458Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1865119710.0
Genevisible245302_at0.0
Expression AtlasAT4G17695-
AtGenExpressAT4G17695-
ATTED-IIAT4G17695-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in developing phloem. {ECO:0000269|PubMed:14561401}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that regulates lateral organ polarity. Plays a role in lateral root formation and development. {ECO:0000269|PubMed:15286295, ECO:0000269|PubMed:17307928}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT4G17695.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT4G17695
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0486900.0AY048690.1 Arabidopsis thaliana GARP-like putative transcription factor KANADI3 (KAN3) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_567535.10.0Homeodomain-like superfamily protein
SwissprotQ941I20.0KAN3_ARATH; Probable transcription factor KAN3
TrEMBLA0A178UXT90.0A0A178UXT9_ARATH; Uncharacterized protein
STRINGAT4G17695.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM139841825
Representative plantOGRP5701580
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Eshed Y,Baum SF,Perea JV,Bowman JL
    Establishment of polarity in lateral organs of plants.
    Curr. Biol., 2001. 11(16): p. 1251-60
    [PMID:11525739]
  3. Emery JF, et al.
    Radial patterning of Arabidopsis shoots by class III HD-ZIP and KANADI genes.
    Curr. Biol., 2003. 13(20): p. 1768-74
    [PMID:14561401]
  4. Hawker NP,Bowman JL
    Roles for Class III HD-Zip and KANADI genes in Arabidopsis root development.
    Plant Physiol., 2004. 135(4): p. 2261-70
    [PMID:15286295]
  5. Zhao C,Craig JC,Petzold HE,Dickerman AW,Beers EP
    The xylem and phloem transcriptomes from secondary tissues of the Arabidopsis root-hypocotyl.
    Plant Physiol., 2005. 138(2): p. 803-18
    [PMID:15923329]
  6. Izhaki A,Bowman JL
    KANADI and class III HD-Zip gene families regulate embryo patterning and modulate auxin flow during embryogenesis in Arabidopsis.
    Plant Cell, 2007. 19(2): p. 495-508
    [PMID:17307928]