PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT4G17570.3
Common NameGATA26
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family GATA
Protein Properties Length: 514aa    MW: 57368.4 Da    PI: 7.4991
Description GATA transcription factor 26
Gene Model
Gene Model ID Type Source Coding Sequence
AT4G17570.3genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA50.13.7e-16741135
         GATA  1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35
                 C +Cg+t+TplWR+gp  ++ LCnaCG ++r kg+
  AT4G17570.3  7 CYHCGVTNTPLWRNGPPEKPVLCNACGSRWRTKGT 41
                 ****************88888***********997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004011.0E-10155IPR000679Zinc finger, GATA-type
SuperFamilySSF577161.09E-11546No hitNo description
CDDcd002021.01E-16651No hitNo description
Gene3DG3DSA:3.30.50.101.9E-12741IPR013088Zinc finger, NHR/GATA-type
PfamPF003204.9E-14741IPR000679Zinc finger, GATA-type
PROSITE profilePS5011411.095740IPR000679Zinc finger, GATA-type
PROSITE patternPS003440732IPR000679Zinc finger, GATA-type
PfamPF139193.0E-10273373IPR028020ASX homology domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0030154Biological Processcell differentiation
GO:0005634Cellular Componentnucleus
GO:0005667Cellular Componenttranscription factor complex
GO:0000977Molecular FunctionRNA polymerase II regulatory region sequence-specific DNA binding
GO:0001085Molecular FunctionRNA polymerase II transcription factor binding
GO:0001228Molecular Functiontranscriptional activator activity, RNA polymerase II transcription regulatory region sequence-specific binding
GO:0003682Molecular Functionchromatin binding
GO:0008270Molecular Functionzinc ion binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 514 aa     Download sequence    Send to blast
MGKQGPCYHC GVTNTPLWRN GPPEKPVLCN ACGSRWRTKG TLVNYTPLHA RADGDENDDH  60
HRFQRMKSIS LGNKNKEIKM LKRKAIQENI IIKRPVFEFS YGLKAAVIEE DASNRSSSGS  120
AVSNSESCAQ FSSADGSELT GPSQSNAWDT TVPCKRRTCV GRPKSSSVEK LTKDLYNILQ  180
EQQSSCLSVS SEEDLLFENE MSMVSVEIGH GSVLMKNPHS FAREEESEAS SLSSIENKSS  240
ISDAYSHSVK RVEIGAVRGS YYGGQTIKQE QFKRTKSQTE RVHVLGSHGS PLCSIDLKDV  300
FNFDEFIEQF TEEEQKKLMN LLPQIDSDDL PHSLRMMFES AQFKDNFSLF QQLIADGVFD  360
VSSSSGAKLE EIRTFKKLAL TDFNKSRLVE SYNLLKEREK GTGDSVTTTS KSSIPNVPKN  420
IVTIKRRYEN QIQVKSESRG LMRSPKRVMK MKASHETENN VSCFRPRSLA SVFAQEGGSA  480
VFSYEGNCSS DQDLLLLDLP SNGSFPQAEL LHQL
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.273020.0flower| root
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible245428_at0.0
Expression AtlasAT4G17570-
AtGenExpressAT4G17570-
ATTED-IIAT4G17570-
Functional Description ? help Back to Top
Source Description
TAIREncodes a member of the GATA factor family of zinc finger transcription factors.
UniProtTranscriptional regulator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT4G17570.3
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT4G17570
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0625620.0AY062562.1 Arabidopsis thaliana Unknown protein (Z97343.42) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001190754.10.0GATA transcription factor 26
SwissprotQ8W4H10.0GAT26_ARATH; GATA transcription factor 26
TrEMBLA0A178V5X00.0A0A178V5X0_ARATH; GATA26
TrEMBLF4JP790.0F4JP79_ARATH; GATA transcription factor 26
STRINGAT4G17570.20.0(Arabidopsis thaliana)
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Bancroft I
    Duplicate and diverge: the evolution of plant genome microstructure.
    Trends Genet., 2001. 17(2): p. 89-93
    [PMID:11173118]
  3. Reyes JC,Muro-Pastor MI,Florencio FJ
    The GATA family of transcription factors in Arabidopsis and rice.
    Plant Physiol., 2004. 134(4): p. 1718-32
    [PMID:15084732]
  4. Rana D, et al.
    Conservation of the microstructure of genome segments in Brassica napus and its diploid relatives.
    Plant J., 2004. 40(5): p. 725-33
    [PMID:15546355]
  5. Bi YM, et al.
    Genetic analysis of Arabidopsis GATA transcription factor gene family reveals a nitrate-inducible member important for chlorophyll synthesis and glucose sensitivity.
    Plant J., 2005. 44(4): p. 680-92
    [PMID:16262716]
  6. Liu PP,Koizuka N,Martin RC,Nonogaki H
    The BME3 (Blue Micropylar End 3) GATA zinc finger transcription factor is a positive regulator of Arabidopsis seed germination.
    Plant J., 2005. 44(6): p. 960-71
    [PMID:16359389]
  7. Town CD, et al.
    Comparative genomics of Brassica oleracea and Arabidopsis thaliana reveal gene loss, fragmentation, and dispersal after polyploidy.
    Plant Cell, 2006. 18(6): p. 1348-59
    [PMID:16632643]
  8. Manfield IW,Devlin PF,Jen CH,Westhead DR,Gilmartin PM
    Conservation, convergence, and divergence of light-responsive, circadian-regulated, and tissue-specific expression patterns during evolution of the Arabidopsis GATA gene family.
    Plant Physiol., 2007. 143(2): p. 941-58
    [PMID:17208962]
  9. Ascencio-Ib
    Global analysis of Arabidopsis gene expression uncovers a complex array of changes impacting pathogen response and cell cycle during geminivirus infection.
    Plant Physiol., 2008. 148(1): p. 436-54
    [PMID:18650403]