PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT4G17460.1
Common Namedl4765w, FCAALL.65, HAT1, JAB
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family HD-ZIP
Protein Properties Length: 282aa    MW: 31554.6 Da    PI: 8.5945
Description Homeobox-leucine zipper protein 4 (HB-4) / HD-ZIP protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT4G17460.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox603.7e-19134188256
                  T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
     Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                  rk+ +++k+q  +Le+ F+++++++ +++  LAkklgLt rqV vWFqNrRa+ k
  AT4G17460.1 134 RKKLRLSKDQSAVLEDTFKEHNTLNPKQKLALAKKLGLTARQVEVWFQNRRARTK 188
                  677889***********************************************98 PP

2HD-ZIP_I/II122.81.6e-39134223191
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                  +kk+rlsk+q+++LE++F+e+++L+p++K +la++Lgl++rqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+een+rLeke +eLr +l
  AT4G17460.1 134 RKKLRLSKDQSAVLEDTFKEHNTLNPKQKLALAKKLGLTARQVEVWFQNRRARTKLKQTEVDCEYLKRCVEKLTEENRRLEKEAAELR-AL 223
                  69*************************************************************************************9.54 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046186.4E-27294IPR006712HD-ZIP protein, N-terminal
Gene3DG3DSA:1.10.10.601.5E-18115188IPR009057Homeodomain-like
SuperFamilySSF466896.68E-19118191IPR009057Homeodomain-like
PROSITE profilePS5007117.135130190IPR001356Homeobox domain
SMARTSM003891.9E-17132194IPR001356Homeobox domain
PfamPF000461.5E-16134188IPR001356Homeobox domain
CDDcd000864.79E-16134191No hitNo description
PRINTSPR000317.5E-6161170IPR000047Helix-turn-helix motif
PROSITE patternPS000270165188IPR017970Homeobox, conserved site
PRINTSPR000317.5E-6170186IPR000047Helix-turn-helix motif
PfamPF021838.1E-8190224IPR003106Leucine zipper, homeobox-associated
SMARTSM003401.8E-23190233IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010582Biological Processfloral meristem determinacy
GO:0048467Biological Processgynoecium development
GO:0080127Biological Processfruit septum development
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0043621Molecular Functionprotein self-association
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000056anatomyflower bud
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009001anatomyfruit
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009049anatomyinflorescence
PO:0009052anatomyflower pedicel
PO:0009062anatomygynoecium
PO:0009074anatomystyle
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025034anatomyleaf
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 282 aa     Download sequence    Send to blast
MMMGKEDLGL SLSLGFAQNH PLQLNLKPTS SPMSNLQMFP WNQTLVSSSD QQKQQFLRKI  60
DVNSLPTTVD LEEETGVSSP NSTISSTVSG KRRSTEREGT SGGGCGDDLD ITLDRSSSRG  120
TSDEEEDYGG ETCRKKLRLS KDQSAVLEDT FKEHNTLNPK QKLALAKKLG LTARQVEVWF  180
QNRRARTKLK QTEVDCEYLK RCVEKLTEEN RRLEKEAAEL RALKLSPRLY GQMSPPTTLL  240
MCPSCERVAG PSSSNHNQRS VSLSPWLQMA HGSTFDVMRP RS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1182190RRARTKLKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.197380.0flower| leaf| root| seed| silique
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO5276200.0
Genevisible245362_at0.0
Expression AtlasAT4G17460-
AtGenExpressAT4G17460-
ATTED-IIAT4G17460-
Functional Description ? help Back to Top
Source Description
TAIREncodes homeobox protein HAT1.
UniProtProbable transcription factor. {ECO:0000250}.
Function -- GeneRIF ? help Back to Top
  1. The JAB gene regulates meristematic activity in different tissues, and that it is necessary for the correct formation of the gynoecium at different stages, contributing to a crucial process in plant life: proper fruit development.
    [PMID: 22409594]
  2. HAT1 is a BES1 target gene and that HAT1 functions as a BES1 co-repressor. HAT1 appears to function redundantly with other family members such as HAT3 to mediate brassinosteroid (BR) responses.
    [PMID: 24164091]
  3. While BIN2 phosphorylates and destabilizes BES1/BZR1, BIN2 phosphorylated MYBL2 and HAT1 appear to be stabilized.
    [PMID: 24526246]
  4. HAT1 negatively regulates plant defense responses to Cucumber mosaic virus.
    [PMID: 27328697]
  5. HD-ZIP transcription factors HAT1 can interact with and be phosphorylated by SnRK23 kinase.
    [PMID: 29659577]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00050PBM25215497Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT4G17460.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Interaction ? help Back to Top
Source Intact With
BioGRIDAT1G14920, AT1G19350
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT4G17460
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ4412520.0AJ441252.1 Arabidopsis thaliana mRNA for homeodomain-leucine zipper protein HAT1.
GenBankAK2285870.0AK228587.1 Arabidopsis thaliana mRNA for homeobox-leucine zipper protein HAT1, complete cds, clone: RAFL15-36-J21.
GenBankATU093320.0U09332.1 Arabidopsis thaliana clone HAT1 homeobox protein mRNA, complete cds.
GenBankBT0057560.0BT005756.1 Arabidopsis thaliana clone RAFL15-36-J21 (R50164) putative homeobox-leucine zipper protein HAT1 (HD-Zip protein 1) (At4g17460) mRNA, complete cds.
GenBankBT0061120.0BT006112.1 Arabidopsis thaliana clone U50164 putative homeobox-leucine zipper protein HAT1 (HD-Zip protein 1) (At4g17460) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_193476.10.0Homeobox-leucine zipper protein 4 (HB-4) / HD-ZIP protein
SwissprotP466000.0HAT1_ARATH; Homeobox-leucine zipper protein HAT1
TrEMBLA0A178V5P40.0A0A178V5P4_ARATH; JAB
STRINGAT4G17460.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM15632690
Representative plantOGRP19616156
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Bancroft I
    Duplicate and diverge: the evolution of plant genome microstructure.
    Trends Genet., 2001. 17(2): p. 89-93
    [PMID:11173118]
  3. Dal Bosco C, et al.
    Inactivation of the chloroplast ATP synthase gamma subunit results in high non-photochemical fluorescence quenching and altered nuclear gene expression in Arabidopsis thaliana.
    J. Biol. Chem., 2004. 279(2): p. 1060-9
    [PMID:14576160]
  4. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  5. Pufky J,Qiu Y,Rao MV,Hurban P,Jones AM
    The auxin-induced transcriptome for etiolated Arabidopsis seedlings using a structure/function approach.
    Funct. Integr. Genomics, 2003. 3(4): p. 135-43
    [PMID:14648238]
  6. Hu W,Wang Y,Bowers C,Ma H
    Isolation, sequence analysis, and expression studies of florally expressed cDNAs in Arabidopsis.
    Plant Mol. Biol., 2003. 53(4): p. 545-63
    [PMID:15010618]
  7. Rana D, et al.
    Conservation of the microstructure of genome segments in Brassica napus and its diploid relatives.
    Plant J., 2004. 40(5): p. 725-33
    [PMID:15546355]
  8. Henriksson E, et al.
    Homeodomain leucine zipper class I genes in Arabidopsis. Expression patterns and phylogenetic relationships.
    Plant Physiol., 2005. 139(1): p. 509-18
    [PMID:16055682]
  9. Deng X, et al.
    A homeodomain leucine zipper gene from Craterostigma plantagineum regulates abscisic acid responsive gene expression and physiological responses.
    Plant Mol. Biol., 2006. 61(3): p. 469-89
    [PMID:16830180]
  10. Soitamo AJ,Piippo M,Allahverdiyeva Y,Battchikova N,Aro EM
    Light has a specific role in modulating Arabidopsis gene expression at low temperature.
    BMC Plant Biol., 2008. 8: p. 13
    [PMID:18230142]
  11. Ascencio-Ib
    Global analysis of Arabidopsis gene expression uncovers a complex array of changes impacting pathogen response and cell cycle during geminivirus infection.
    Plant Physiol., 2008. 148(1): p. 436-54
    [PMID:18650403]
  12. Ciarbelli AR, et al.
    The Arabidopsis homeodomain-leucine zipper II gene family: diversity and redundancy.
    Plant Mol. Biol., 2008. 68(4-5): p. 465-78
    [PMID:18758690]
  13. Krishnaswamy SS, et al.
    Transcriptional profiling of pea ABR17 mediated changes in gene expression in Arabidopsis thaliana.
    BMC Plant Biol., 2008. 8: p. 91
    [PMID:18783601]
  14. Sorin C,Salla-Martret M,Bou-Torrent J,Roig-Villanova I,Martínez-García JF
    ATHB4, a regulator of shade avoidance, modulates hormone response in Arabidopsis seedlings.
    Plant J., 2009. 59(2): p. 266-77
    [PMID:19392702]
  15. Hanada K, et al.
    Functional compensation of primary and secondary metabolites by duplicate genes in Arabidopsis thaliana.
    Mol. Biol. Evol., 2011. 28(1): p. 377-82
    [PMID:20736450]
  16. Causier B,Ashworth M,Guo W,Davies B
    The TOPLESS interactome: a framework for gene repression in Arabidopsis.
    Plant Physiol., 2012. 158(1): p. 423-38
    [PMID:22065421]
  17. Z
    JAIBA, a class-II HD-ZIP transcription factor involved in the regulation of meristematic activity, and important for correct gynoecium and fruit development in Arabidopsis.
    Plant J., 2012. 71(2): p. 314-26
    [PMID:22409594]
  18. Z
    The class II HD-ZIP JAIBA gene is involved in meristematic activity and important for gynoecium and fruit development in Arabidopsis.
    Plant Signal Behav, 2012. 7(11): p. 1501-3
    [PMID:22951401]
  19. Zhang D, et al.
    Transcription factor HAT1 is phosphorylated by BIN2 kinase and mediates brassinosteroid repressed gene expression in Arabidopsis.
    Plant J., 2014. 77(1): p. 59-70
    [PMID:24164091]
  20. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  21. Zhang D, et al.
    Transcription factors involved in brassinosteroid repressed gene expression and their regulation by BIN2 kinase.
    Plant Signal Behav, 2014. 9(1): p. e27849
    [PMID:24526246]
  22. Mar
    Large-scale identification of gibberellin-related transcription factors defines group VII ETHYLENE RESPONSE FACTORS as functional DELLA partners.
    Plant Physiol., 2014. 166(2): p. 1022-32
    [PMID:25118255]
  23. Zou LJ, et al.
    Role of Transcription Factor HAT1 in Modulating Arabidopsis thaliana Response to Cucumber mosaic virus.
    Plant Cell Physiol., 2016. 57(9): p. 1879-89
    [PMID:27328697]
  24. Lozano-Sotomayor P, et al.
    Altered expression of the bZIP transcription factor DRINK ME affects growth and reproductive development in Arabidopsis thaliana.
    Plant J., 2016. 88(3): p. 437-451
    [PMID:27402171]
  25. Tan W, et al.
    Transcription factor HAT1 is a substrate of SnRK2.3 kinase and negatively regulates ABA synthesis and signaling in Arabidopsis responding to drought.
    PLoS Genet., 2018. 14(4): p. e1007336
    [PMID:29659577]
  26. Schena M,Davis RW
    Structure of homeobox-leucine zipper genes suggests a model for the evolution of gene families.
    Proc. Natl. Acad. Sci. U.S.A., 1994. 91(18): p. 8393-7
    [PMID:7915839]