PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT4G16141.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family GATA
Protein Properties Length: 197aa    MW: 21183.3 Da    PI: 10.6666
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT4G16141.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA56.24.6e-183973135
         GATA  1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35
                 C+ Cgt+ TplWR gp g+k+LCnaCG++ rkk++
  AT4G16141.1 39 CVDCGTSRTPLWRGGPAGPKSLCNACGIKSRKKRQ 73
                 *********************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004011.7E-113384IPR000679Zinc finger, GATA-type
PROSITE profilePS5011412.2423388IPR000679Zinc finger, GATA-type
SuperFamilySSF577169.03E-123473No hitNo description
Gene3DG3DSA:3.30.50.101.1E-143773IPR013088Zinc finger, NHR/GATA-type
CDDcd002027.81E-113888No hitNo description
PfamPF003205.9E-163973IPR000679Zinc finger, GATA-type
PROSITE patternPS0034403964IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0030154Biological Processcell differentiation
GO:0045944Biological Processpositive regulation of transcription from RNA polymerase II promoter
GO:0005634Cellular Componentnucleus
GO:0005667Cellular Componenttranscription factor complex
GO:0000977Molecular FunctionRNA polymerase II regulatory region sequence-specific DNA binding
GO:0001085Molecular FunctionRNA polymerase II transcription factor binding
GO:0001228Molecular Functiontranscriptional activator activity, RNA polymerase II transcription regulatory region sequence-specific binding
GO:0003682Molecular Functionchromatin binding
GO:0008270Molecular Functionzinc ion binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000293anatomyguard cell
Sequence ? help Back to Top
Protein Sequence    Length: 197 aa     Download sequence    Send to blast
MSMTEETKTT KLESAGDSSD VDNGNCSSSG SGGDTKKTCV DCGTSRTPLW RGGPAGPKSL  60
CNACGIKSRK KRQAALGIRQ DDIKIKSKSN NNLGLESRNV KTGKGEPVNV KIAKCEPGIV  120
KIAKGEPGNV KNKIKRDPEN SSSSNNNKKN VKRVGRFLDF GFKVPAMKRS AVEKKRLWRK  180
LGEEERAAVL LMALSCG
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.442710.0flower| inflorescence| root| seed
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO2402559050.0
Expression AtlasAT4G16141-
AtGenExpressAT4G16141-
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT4G16141.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT4G16141
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1190210.0AK119021.1 Arabidopsis thaliana At4g16141 mRNA for unknown protein, complete cds, clone: RAFL21-34-K14.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_680707.41e-139GATA type zinc finger transcription factor family protein
SwissprotQ9LIB51e-60GAT17_ARATH; GATA transcription factor 17
TrEMBLQ8GW811e-139Q8GW81_ARATH; GATA type zinc finger transcription factor family protein
STRINGAT4G16141.11e-139(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6817287
MalvidsOGEM138161624
Publications ? help Back to Top
  1. Bi YM, et al.
    Genetic analysis of Arabidopsis GATA transcription factor gene family reveals a nitrate-inducible member important for chlorophyll synthesis and glucose sensitivity.
    Plant J., 2005. 44(4): p. 680-92
    [PMID:16262716]
  2. Manfield IW,Devlin PF,Jen CH,Westhead DR,Gilmartin PM
    Conservation, convergence, and divergence of light-responsive, circadian-regulated, and tissue-specific expression patterns during evolution of the Arabidopsis GATA gene family.
    Plant Physiol., 2007. 143(2): p. 941-58
    [PMID:17208962]