PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT4G14770.1
Common NameATTCX2, dl3425c, FCAALL.306, SOL2, TCX2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family CPP
Protein Properties Length: 674aa    MW: 74053.5 Da    PI: 5.4801
Description TESMIN/TSO1-like CXC 2
Gene Model
Gene Model ID Type Source Coding Sequence
AT4G14770.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR50.63.8e-16373411240
          TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                  ++k+CnCkkskClk+YCeCfaag++C e C+C dC+Nk 
  AT4G14770.1 373 SCKRCNCKKSKCLKLYCECFAAGVYCIEPCSCIDCFNKP 411
                  689**********************************96 PP

2TCR51.12.7e-16458496139
          TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39 
                  ++k+gCnCkks+ClkkYCeC++ g+ Cs +C+Ce+CkN 
  AT4G14770.1 458 RHKRGCNCKKSNCLKKYCECYQGGVGCSINCRCEGCKNA 496
                  589***********************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011142.3E-19372413IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163437.593373498IPR005172CRC domain
PfamPF036386.4E-12375410IPR005172CRC domain
SMARTSM011143.7E-17458499IPR033467Tesmin/TSO1-like CXC domain
PfamPF036381.1E-11460496IPR005172CRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007275Biological Processmulticellular organism development
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046872Molecular Functionmetal ion binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000084anatomyplant sperm cell
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009052anatomyflower pedicel
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0025022anatomycollective leaf structure
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 674 aa     Download sequence    Send to blast
MDTPQKSITQ IGTPISKSRF EDSPVFNYIN SLSPIRPVRS IPNPNQFSSL NFTSPPSVFT  60
SPHLTSSHKE SRFFKTHNSS SSDPTNSVES QEDESTSHEE VPAEGEDTKG LNIDDCMREE  120
ASVETNLDDS VASPCGGNTT DLSLVPYAPT RGEDGSCEDN GMELQKMHDN VQGKTETPDW  180
ESLIADASEL LIFDSPDASE AFRCFMMQRA SNSEARFRNG VEKQTMQHDS NKEPESANAI  240
PYEAVSLLHR GIRRRCLDFE MPGNKQTSSE NNTAACESSS RCVVPSIGLH LNAILMSSKD  300
CKTNVTQDYS CSANIQVGLQ RSISTLQDSL DQTENEIRED ADQDVPVEPA LQELNLSSPK  360
KKRVKLDSGE GESCKRCNCK KSKCLKLYCE CFAAGVYCIE PCSCIDCFNK PIHEDVVLAT  420
RKQIESRNPL AFAPKVIRNS DSVQETGDDA SKTPASARHK RGCNCKKSNC LKKYCECYQG  480
GVGCSINCRC EGCKNAFGRK DGSSIDMEAE QEEENETSEK SRTAKSQQNT EVLMRKDMSS  540
ALPTTPTPIY RPELVQLPFS SSKNRMPPPQ SLLGGGSSSG IFNSQYLRKP DISLSQSRIE  600
KSFETVAVDG AEQMPEILIH SPIPNIKSVS PNGKRVSPPH MESSSSGSIL GRRNGGRKLI  660
LQSIPSFPSL TPQH
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1358365PKKKRVKL
2358366PKKKRVKLD
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.233800.0silique
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO3341865320.0
Genevisible245576_at0.0
Expression AtlasAT4G14770-
AtGenExpressAT4G14770-
ATTED-IIAT4G14770-
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed at the late stage of pollen development in tricellular and mature pollen. {ECO:0000269|PubMed:18057042}.
UniprotTISSUE SPECIFICITY: Ubiquitous but expressed mostly in all the aerial organs with highest expression in flowers. {ECO:0000269|PubMed:10769245, ECO:0000269|PubMed:18057042}.
Functional Description ? help Back to Top
Source Description
UniProtPlays a role in development of both male and female reproductive tissues. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00433DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT4G14770.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Disruption Phenotype ? help Back to Top
Source Description
UniProtDISRUPTION PHENOTYPE: No visible phenotype. {ECO:0000269|PubMed:22072982}.
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT4G14770
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0026870.0CP002687.1 Arabidopsis thaliana chromosome 4 sequence.
GenBankAL1615390.0AL161539.2 Arabidopsis thaliana DNA chromosome 4, contig fragment No. 39.
GenBankZ973370.0Z97337.2 Arabidopsis thaliana DNA chromosome 4, ESSA I FCA contig fragment No. 2.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_193213.50.0TESMIN/TSO1-like CXC 2
SwissprotF4JIF50.0TCX2_ARATH; Protein tesmin/TSO1-like CXC 2
TrEMBLD7MBC70.0D7MBC7_ARALL; Putative uncharacterized protein
STRINGAT4G14770.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP9931755
MalvidsOGEM14672891
Publications ? help Back to Top
  1. Hauser BA,He JQ,Park SO,Gasser CS
    TSO1 is a novel protein that modulates cytokinesis and cell expansion in Arabidopsis.
    Development, 2000. 127(10): p. 2219-26
    [PMID:10769245]
  2. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  3. Dal Bosco C, et al.
    Inactivation of the chloroplast ATP synthase gamma subunit results in high non-photochemical fluorescence quenching and altered nuclear gene expression in Arabidopsis thaliana.
    J. Biol. Chem., 2004. 279(2): p. 1060-9
    [PMID:14576160]
  4. Vandepoele K, et al.
    Genome-wide identification of potential plant E2F target genes.
    Plant Physiol., 2005. 139(1): p. 316-28
    [PMID:16126853]
  5. Wagner R,Pfannschmidt T
    Eukaryotic transcription factors in plastids--Bioinformatic assessment and implications for the evolution of gene expression machineries in plants.
    Gene, 2006. 381: p. 62-70
    [PMID:16934950]
  6. Fleury D, et al.
    The Arabidopsis thaliana homolog of yeast BRE1 has a function in cell cycle regulation during early leaf and root growth.
    Plant Cell, 2007. 19(2): p. 417-32
    [PMID:17329565]
  7. Andersen SU, et al.
    The conserved cysteine-rich domain of a tesmin/TSO1-like protein binds zinc in vitro and TSO1 is required for both male and female fertility in Arabidopsis thaliana.
    J. Exp. Bot., 2007. 58(13): p. 3657-70
    [PMID:18057042]
  8. Ascencio-Ib
    Global analysis of Arabidopsis gene expression uncovers a complex array of changes impacting pathogen response and cell cycle during geminivirus infection.
    Plant Physiol., 2008. 148(1): p. 436-54
    [PMID:18650403]
  9. Sijacic P,Wang W,Liu Z
    Recessive antimorphic alleles overcome functionally redundant loci to reveal TSO1 function in Arabidopsis flowers and meristems.
    PLoS Genet., 2011. 7(11): p. e1002352
    [PMID:22072982]