PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT4G14540.1
Common Namedl3310w, FCAALL.252, HAP3C, NFYB3, NF-YB3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family NF-YB
Protein Properties Length: 161aa    MW: 17186 Da    PI: 6.1171
Description nuclear factor Y, subunit B3
Gene Model
Gene Model ID Type Source Coding Sequence
AT4G14540.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB188.74e-5920115297
        NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97 
                  reqdrflPianvsrimkk+lPanakiskdaketvqecvsefisf+t+easdkcqrekrktingddllwa++tlGfedyveplkvyl+kyre+egek
  AT4G14540.1  20 REQDRFLPIANVSRIMKKALPANAKISKDAKETVQECVSEFISFITGEASDKCQREKRKTINGDDLLWAMTTLGFEDYVEPLKVYLQKYREVEGEK 115
                  89********************************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.104.9E-5615126IPR009072Histone-fold
SuperFamilySSF471136.68E-4222126IPR009072Histone-fold
PfamPF008083.6E-282589IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006155.4E-225371No hitNo description
PROSITE patternPS0068505672IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006155.4E-227290No hitNo description
PRINTSPR006155.4E-2291109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 161 aa     Download sequence    Send to blast
MADSDNDSGG HKDGGNASTR EQDRFLPIAN VSRIMKKALP ANAKISKDAK ETVQECVSEF  60
ISFITGEASD KCQREKRKTI NGDDLLWAMT TLGFEDYVEP LKVYLQKYRE VEGEKTTTAG  120
RQGDKEGGGG GGGAGSGSGG APMYGGGMVT TMGHQFSHHF S
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B1e-4920110292Transcription factor HapC (Eurofung)
4g92_B1e-4920110292Transcription factor HapC (Eurofung)
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.332690.0flower| vegetative tissue
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible245592_at0.0
Expression AtlasAT4G14540-
AtGenExpressAT4G14540-
ATTED-IIAT4G14540-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Ubiquitous. {ECO:0000269|PubMed:11250072}.
Functional Description ? help Back to Top
Source Description
UniProtComponent of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters.
Function -- GeneRIF ? help Back to Top
  1. The abi4, cbfA and cbp mutants showed weaker drought-tolerance after a herbicide norflurazon treatment, which indicated the physiological role of these key transcription factors.
    [PMID: 23832569]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT4G14540.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Interaction ? help Back to Top
Source Intact With
BioGRIDAT5G12840, AT5G27910, AT5G38140, AT5G50470, AT5G50480, AT5G50490, AT5G63470, AT1G07980, AT1G08970, AT1G30500, AT1G54830, AT1G56170, AT1G72830
IntActSearch O23310
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT4G14540
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0026870.0CP002687.1 Arabidopsis thaliana chromosome 4 sequence.
GenBankBT0036840.0BT003684.1 Arabidopsis thaliana At4g14540 mRNA, complete cds.
GenBankAL1615390.0AL161539.2 Arabidopsis thaliana DNA chromosome 4, contig fragment No. 39.
GenBankAK1178180.0AK117818.1 Arabidopsis thaliana At4g14540 mRNA for putative CCAAT-binding transcription factor subunit A(CBF-A), complete cds, clone: RAFL18-01-N02.
GenBankZ973360.0Z97336.1 Arabidopsis thaliana DNA chromosome 4, ESSA I FCA contig fragment No. 1.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_193190.11e-117nuclear transcription factor Y subunit B-3
SwissprotO233101e-119NFYB3_ARATH; Nuclear transcription factor Y subunit B-3
TrEMBLD7MH071e-116D7MH07_ARALL; CCAAT-box binding transcription factor subunit B (NF-YB) family
STRINGAT4G14540.11e-117(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP16817170
MalvidsOGEM25528229
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Gusmaroli G,Tonelli C,Mantovani R
    Regulation of the CCAAT-Binding NF-Y subunits in Arabidopsis thaliana.
    Gene, 2001. 264(2): p. 173-85
    [PMID:11250072]
  3. Gusmaroli G,Tonelli C,Mantovani R
    Regulation of novel members of the Arabidopsis thaliana CCAAT-binding nuclear factor Y subunits.
    Gene, 2002. 283(1-2): p. 41-8
    [PMID:11867211]
  4. Seki M, et al.
    Functional annotation of a full-length Arabidopsis cDNA collection.
    Science, 2002. 296(5565): p. 141-5
    [PMID:11910074]
  5. Che P,Gingerich DJ,Lall S,Howell SH
    Global and hormone-induced gene expression changes during shoot development in Arabidopsis.
    Plant Cell, 2002. 14(11): p. 2771-85
    [PMID:12417700]
  6. Kwong RW, et al.
    LEAFY COTYLEDON1-LIKE defines a class of regulators essential for embryo development.
    Plant Cell, 2003. 15(1): p. 5-18
    [PMID:12509518]
  7. Lee H,Fischer RL,Goldberg RB,Harada JJ
    Arabidopsis LEAFY COTYLEDON1 represents a functionally specialized subunit of the CCAAT binding transcription factor.
    Proc. Natl. Acad. Sci. U.S.A., 2003. 100(4): p. 2152-6
    [PMID:12578989]
  8. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  9. Hoth S, et al.
    Monitoring genome-wide changes in gene expression in response to endogenous cytokinin reveals targets in Arabidopsis thaliana.
    FEBS Lett., 2003. 554(3): p. 373-80
    [PMID:14623097]
  10. Czechowski T,Bari RP,Stitt M,Scheible WR,Udvardi MK
    Real-time RT-PCR profiling of over 1400 Arabidopsis transcription factors: unprecedented sensitivity reveals novel root- and shoot-specific genes.
    Plant J., 2004. 38(2): p. 366-79
    [PMID:15078338]
  11. Wenkel S, et al.
    CONSTANS and the CCAAT box binding complex share a functionally important domain and interact to regulate flowering of Arabidopsis.
    Plant Cell, 2006. 18(11): p. 2971-84
    [PMID:17138697]
  12. Osuna D, et al.
    Temporal responses of transcripts, enzyme activities and metabolites after adding sucrose to carbon-deprived Arabidopsis seedlings.
    Plant J., 2007. 49(3): p. 463-91
    [PMID:17217462]
  13. Ascencio-Ib
    Global analysis of Arabidopsis gene expression uncovers a complex array of changes impacting pathogen response and cell cycle during geminivirus infection.
    Plant Physiol., 2008. 148(1): p. 436-54
    [PMID:18650403]
  14. Liu JX,Howell SH
    bZIP28 and NF-Y transcription factors are activated by ER stress and assemble into a transcriptional complex to regulate stress response genes in Arabidopsis.
    Plant Cell, 2010. 22(3): p. 782-96
    [PMID:20207753]
  15. Kumimoto RW,Zhang Y,Siefers N,Holt BF
    NF-YC3, NF-YC4 and NF-YC9 are required for CONSTANS-mediated, photoperiod-dependent flowering in Arabidopsis thaliana.
    Plant J., 2010. 63(3): p. 379-91
    [PMID:20487380]
  16. Arabidopsis Interactome Mapping Consortium
    Evidence for network evolution in an Arabidopsis interactome map.
    Science, 2011. 333(6042): p. 601-7
    [PMID:21798944]
  17. Liang M,Hole D,Wu J,Blake T,Wu Y
    Expression and functional analysis of NUCLEAR FACTOR-Y, subunit B genes in barley.
    Planta, 2012. 235(4): p. 779-91
    [PMID:22042327]
  18. Hackenberg D, et al.
    Studies on differential nuclear translocation mechanism and assembly of the three subunits of the Arabidopsis thaliana transcription factor NF-Y.
    Mol Plant, 2012. 5(4): p. 876-88
    [PMID:22199235]
  19. Calvenzani V, et al.
    Interactions and CCAAT-binding of Arabidopsis thaliana NF-Y subunits.
    PLoS ONE, 2012. 7(8): p. e42902
    [PMID:22912760]
  20. Zhang ZW, et al.
    The roles of two transcription factors, ABI4 and CBFA, in ABA and plastid signalling and stress responses.
    Plant Mol. Biol., 2013. 83(4-5): p. 445-58
    [PMID:23832569]
  21. Hou X, et al.
    Nuclear factor Y-mediated H3K27me3 demethylation of the SOC1 locus orchestrates flowering responses of Arabidopsis.
    Nat Commun, 2014. 5: p. 4601
    [PMID:25105952]
  22. Sato H, et al.
    Arabidopsis DPB3-1, a DREB2A interactor, specifically enhances heat stress-induced gene expression by forming a heat stress-specific transcriptional complex with NF-Y subunits.
    Plant Cell, 2014. 26(12): p. 4954-73
    [PMID:25490919]