PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT4G13480.1
Common NameAtMYB79, MYB79, T6G15.30
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB
Protein Properties Length: 261aa    MW: 30141 Da    PI: 9.5114
Description myb domain protein 79
Gene Model
Gene Model ID Type Source Coding Sequence
AT4G13480.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.12e-18855148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd ll+++v+ +G g+W+++++  g++R +k+c++rw +yl
      AT4G13480.1  8 KGPWTAEEDRLLIEYVRVHGEGRWNSVSKLAGLKRNGKSCRLRWVNYL 55
                     79********************************************97 PP

2Myb_DNA-binding52.79.8e-1761105147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg  T+ E+ +++++++++G++ W+tIar ++ gRt++++k++w+++
      AT4G13480.1  61 RGQITPHEESIILELHAKWGNR-WSTIARSLP-GRTDNEIKNYWRTH 105
                      7888******************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.975155IPR017930Myb domain
SuperFamilySSF466894.12E-307102IPR009057Homeodomain-like
SMARTSM007172.1E-16757IPR001005SANT/Myb domain
PfamPF002492.5E-17855IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.0E-23962IPR009057Homeodomain-like
CDDcd001674.79E-121055No hitNo description
PROSITE profilePS5129424.75956110IPR017930Myb domain
SMARTSM007173.9E-1560108IPR001005SANT/Myb domain
PfamPF002495.8E-1461105IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.6E-2463109IPR009057Homeodomain-like
CDDcd001671.01E-1065106No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0030154Biological Processcell differentiation
GO:0005634Cellular Componentnucleus
GO:0000981Molecular FunctionRNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001135Molecular Functiontranscription factor activity, RNA polymerase II transcription factor recruiting
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 261 aa     Download sequence    Send to blast
MVEEVWRKGP WTAEEDRLLI EYVRVHGEGR WNSVSKLAGL KRNGKSCRLR WVNYLRPDLK  60
RGQITPHEES IILELHAKWG NRWSTIARSL PGRTDNEIKN YWRTHFKKKA KPTTNNAEKI  120
KSRLLKRQHF KEQREIELQQ EQQLFQFDQL GMKKIISLLE ENNSSSSSDG GGDVFYYPDQ  180
ITHSSKPFGY NSNSLEEQLQ GRFSPVNIPD ANTMNEDNAI WDGFWNMDVV NGHGGNLGVV  240
AATAACGPRK PYFHNLVIPF C
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-26811027128MYB TRANSFORMING PROTEIN
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO306824980.0
Genevisible254714_at0.0
Expression AtlasAT4G13480-
AtGenExpressAT4G13480-
ATTED-IIAT4G13480-
Functional Description ? help Back to Top
Source Description
TAIRMember of the R2R3 factor gene family.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT4G13480.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Interaction ? help Back to Top
Source Intact With
BioGRIDAT5G11260
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT4G13480
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY1337050.0AY133705.1 Arabidopsis thaliana clone C103160 putative myb protein (At4g13480) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_193084.10.0myb domain protein 79
TrEMBLQ9T0G90.0Q9T0G9_ARATH; Myb domain protein 79
STRINGAT4G13480.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM31072766
Representative plantOGRP5171784
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Stracke R,Werber M,Weisshaar B
    The R2R3-MYB gene family in Arabidopsis thaliana.
    Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56
    [PMID:11597504]
  3. Czechowski T,Bari RP,Stitt M,Scheible WR,Udvardi MK
    Real-time RT-PCR profiling of over 1400 Arabidopsis transcription factors: unprecedented sensitivity reveals novel root- and shoot-specific genes.
    Plant J., 2004. 38(2): p. 366-79
    [PMID:15078338]
  4. Yanhui C, et al.
    The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family.
    Plant Mol. Biol., 2006. 60(1): p. 107-24
    [PMID:16463103]
  5. Gong W, et al.
    The development of protein microarrays and their applications in DNA-protein and protein-protein interaction analyses of Arabidopsis transcription factors.
    Mol Plant, 2008. 1(1): p. 27-41
    [PMID:19802365]
  6. Hanada K, et al.
    Functional compensation of primary and secondary metabolites by duplicate genes in Arabidopsis thaliana.
    Mol. Biol. Evol., 2011. 28(1): p. 377-82
    [PMID:20736450]