PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT4G12850.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family FAR1
Protein Properties Length: 138aa    MW: 15903.2 Da    PI: 10.0833
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT4G12850.2genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR179.27.8e-2525110190
         FAR1   1 kfYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHela 90 
                  +fY eY+k++GF vr+ + ++s  +g++  r++ C+k+g+  +++++    +++++++r gCka++ vk+ek+gkw+vt++ +eHnH+l+
  AT4G12850.2  25 DFYVEYSKRLGFVVRMMQRRRSGIDGRTLARRLGCNKQGFGPNNQRS----SSSSSSSREGCKATILVKMEKSGKWVVTRFIKEHNHSLQ 110
                  6****************************************999888....89999*******************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031017.3E-2325110IPR004330FAR1 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009585Biological Processred, far-red light phototransduction
GO:0010018Biological Processfar-red light signaling pathway
GO:0042753Biological Processpositive regulation of circadian rhythm
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000293anatomyguard cell
Sequence ? help Back to Top
Protein Sequence    Length: 138 aa     Download sequence    Send to blast
MMTGDLKLDE PYVGLKFESE EEAKDFYVEY SKRLGFVVRM MQRRRSGIDG RTLARRLGCN  60
KQGFGPNNQR SSSSSSSSRE GCKATILVKM EKSGKWVVTR FIKEHNHSLQ FIGSSSYDSF  120
VRFQSLYLWV FLICFAIT
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.334400.0flower| seed
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasAT4G12850
AtGenExpressAT4G12850
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT4G12850.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT4G12850
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0026870.0CP002687.1 Arabidopsis thaliana chromosome 4 sequence.
GenBankBT0123870.0BT012387.1 Arabidopsis thaliana At4g12850 mRNA, complete cds.
GenBankBT0117700.0BT011770.1 Arabidopsis thaliana At4g12850 mRNA, complete cds.
GenBankAL1615350.0AL161535.2 Arabidopsis thaliana DNA chromosome 4, contig fragment No. 35.
GenBankAL0496400.0AL049640.1 Arabidopsis thaliana DNA chromosome 4, BAC clone T20K18 (ESSA project).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001078380.12e-99Far-red impaired responsive (FAR1) family protein
TrEMBLQ6NLE73e-99Q6NLE7_ARATH; At4g12850
STRINGAT4G12850.14e-83(Arabidopsis thaliana)
Publications ? help Back to Top
  1. Goda H, et al.
    Comprehensive comparison of auxin-regulated and brassinosteroid-regulated genes in Arabidopsis.
    Plant Physiol., 2004. 134(4): p. 1555-73
    [PMID:15047898]
  2. Rehrauer H, et al.
    AGRONOMICS1: a new resource for Arabidopsis transcriptome profiling.
    Plant Physiol., 2010. 152(2): p. 487-99
    [PMID:20032078]