PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT4G12850.1
Common NameT20K18.200
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family FAR1
Protein Properties Length: 183aa    MW: 21250.1 Da    PI: 8.4649
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT4G12850.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR178.11.7e-2424109190
         FAR1   1 kfYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHela 90 
                  +fY eY+k++GF vr+ + ++s  +g++  r++ C+k+g+  +++++    +++++++r gCka++ vk+ek+gkw+vt++ +eHnH+l+
  AT4G12850.1  24 DFYVEYSKRLGFVVRMMQRRRSGIDGRTLARRLGCNKQGFGPNNQRS----SSSSSSSREGCKATILVKMEKSGKWVVTRFIKEHNHSLQ 109
                  6****************************************999888....89999*******************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031011.6E-2224109IPR004330FAR1 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009585Biological Processred, far-red light phototransduction
GO:0010018Biological Processfar-red light signaling pathway
GO:0042753Biological Processpositive regulation of circadian rhythm
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000293anatomyguard cell
Sequence ? help Back to Top
Protein Sequence    Length: 183 aa     Download sequence    Send to blast
MTGDLKLDEP YVGLKFESEE EAKDFYVEYS KRLGFVVRMM QRRRSGIDGR TLARRLGCNK  60
QGFGPNNQRS SSSSSSSREG CKATILVKME KSGKWVVTRF IKEHNHSLQF IGSSSYDSFA  120
DKERKIKELT EEIECQDRLC DVYRDRLVSF IDNVEHYTEE LSLKVRDIVE NVKKLECQIQ  180
TRA
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.334400.0flower| seed
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasAT4G12850
AtGenExpressAT4G12850
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT4G12850.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT4G12850
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0120770.0BT012077.1 Arabidopsis thaliana At4g12850 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_193021.11e-133Far-red impaired responsive (FAR1) family protein
TrEMBLQ9SU011e-133Q9SU01_ARATH; Far-red impaired responsive (FAR1) family protein
STRINGAT4G12850.11e-133(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP3376727
MalvidsOGEM39182855
Publications ? help Back to Top
  1. Goda H, et al.
    Comprehensive comparison of auxin-regulated and brassinosteroid-regulated genes in Arabidopsis.
    Plant Physiol., 2004. 134(4): p. 1555-73
    [PMID:15047898]
  2. Rehrauer H, et al.
    AGRONOMICS1: a new resource for Arabidopsis transcriptome profiling.
    Plant Physiol., 2010. 152(2): p. 487-99
    [PMID:20032078]