PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT4G12750.1
Common NameRLT3, T20K18.100
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family HB-other
Protein Properties Length: 1131aa    MW: 127805 Da    PI: 7.93
Description Homeodomain-like transcriptional regulator
Gene Model
Gene Model ID Type Source Coding Sequence
AT4G12750.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox375.6e-12553856
                 -HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
     Homeobox  8 tkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                 ++ q+++Le ++ +++yp+ +e+e+L k+lgLt + V+ WF+ rR + k
  AT4G12750.1  5 SPLQVQALEGFYLEQMYPTPKEMEDLGKSLGLTLKEVRGWFKRRRSRGK 53
                 688*******************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003898.2E-9159IPR001356Homeobox domain
PROSITE profilePS5007113.07155IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.6E-11354IPR009057Homeodomain-like
SuperFamilySSF466891.67E-10353IPR009057Homeodomain-like
CDDcd000863.12E-11351No hitNo description
PfamPF000461.6E-9553IPR001356Homeobox domain
SMARTSM005711.7E-9365424IPR018501DDT domain
PROSITE profilePS5082712.624365424IPR018501DDT domain
PfamPF027911.9E-9366419IPR018501DDT domain
PfamPF156125.1E-8645685IPR028942WHIM1 domain
PfamPF156134.7E-11768841IPR028941WHIM2 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009908Biological Processflower development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000084anatomyplant sperm cell
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 1131 aa     Download sequence    Send to blast
MKRKSPLQVQ ALEGFYLEQM YPTPKEMEDL GKSLGLTLKE VRGWFKRRRS RGKGVKSMAN  60
DGLGAKNPQL YDRSLMRSST SSRCVGVAVE ERCIVGTRKA SCQNLLPSSH ILAKVFRKDG  120
PSLGSEFDHL PSGARKASWL GTSSVGQQKQ KVARKRKISE LMDHTSQDCI QENATVMKHG  180
IGKGLMTVWR VMNPNRRDVS PCVDLLDERA TLPQSSARNP PHQKKKQRQL ASILKQKLLQ  240
KRSTEKKRRS IHREAELNKD ETQREFKENC ELAADGEVFK ETCQTISTLV DDEELEMRER  300
HERGNPLTCS CHHPSSGSHG CFLCKGIAMR SSDSSLLFPD LLPKFPPNSV QMRMPFGLHP  360
WNSSPESVKK LFKVVHFLYT YSVTLDIGPF TLDEFTRAFH DKDSLLLGKI HLSLLKLLLL  420
DVETELERGS FSNLSISCKF LALLQSVESQ ILILDMWRNS LNSLTWTELL RQILVAAGYG  480
SLKCAVQSEE LSKERKLMKK YGLRLGTLKG ELFRMLNGQG NNGLKISELA DAPEVAVLNL  540
ATVPEERENS ICSTLASDIT LFEKISESTY RVRVNCFSED PDKSQSDSDD SGSVDDESDD  600
CSISSGDEIE HVSENPALRK VKCRKRRKHK SKMREVCSEI DESHPGEPWL LGLMEGEYSD  660
LSVEEKLDVF VALIDLLSSG STIRMEDLPR AVADCAPSIY SHGSGGKIKR SSSNQYSYPR  720
GSWVHGGELY GIKALSKSSD SHPVDSSSIV GAFAKLAGNR ANNVHPMQSV YLGSDRRFNR  780
YWLFLGTCNA NDPGHRCVFF ESSEDGHWEV INNKEALRAL LSVLDDRGRR EARLIESLEK  840
RESFLCQAML SRQVTQSETA HFTDIVREDS SSPVSDIDNN LCLNEIANDQ FSSQHAAIVF  900
EIGSKREKSL LWSLIQEFDD WIWANFNFNL NSVKHRRRSY LDSLTRCKSC HDLYWRDEKH  960
CKICHATFEV DIDLEERYAI HAATCMRKEE CDTFPDHKVL SSQLQSLKAA VYAIESAMPE  1020
DALIGAWRKS AHRLWAKRLR RSSSVSEITQ VIGDFVGAIN EEWLWHCSDQ GQTLMGEIIN  1080
CFPSMPQTTS AIALWLVKLD TLIAPYVEKA PPERDQPLCR TRNTSRRASK R
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.463670.0flower
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO3341864610.0
Genevisible254778_at0.0
Expression AtlasAT4G12750-
AtGenExpressAT4G12750-
ATTED-IIAT4G12750-
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional regulator required for the maintenance of the plant vegetative phase. May prevent the early activation of the vegetative-to-reproductive transition by regulating key genes that contribute to flower timing. {ECO:0000250|UniProtKB:F4HY56}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT4G12750.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT4G12750
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAL0496400.0AL049640.1 Arabidopsis thaliana DNA chromosome 4, BAC clone T20K18 (ESSA project).
GenBankAL1615340.0AL161534.2 Arabidopsis thaliana DNA chromosome 4, contig fragment No. 34.
GenBankCP0026870.0CP002687.1 Arabidopsis thaliana chromosome 4 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001319916.10.0Homeodomain-like transcriptional regulator
SwissprotF4JRF50.0RLT3_ARATH; Homeobox-DDT domain protein RLT3
TrEMBLA0A2H1ZEL50.0A0A2H1ZEL5_ARATH; Homeodomain-like transcriptional regulator
STRINGAT4G12750.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM96382125
Representative plantOGRP916177
Publications ? help Back to Top
  1. Panjabi P, et al.
    Comparative mapping of Brassica juncea and Arabidopsis thaliana using Intron Polymorphism (IP) markers: homoeologous relationships, diversification and evolution of the A, B and C Brassica genomes.
    BMC Genomics, 2008. 9: p. 113
    [PMID:18315867]
  2. MakaƂowska I
    Comparative analysis of an unusual gene arrangement in the human chromosome 1.
    Gene, 2008. 423(2): p. 172-9
    [PMID:18672041]