PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT4G12020.3
Common NameATWRKY19, MAPKKK11, MEKK4, WRKY19
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family WRKY
Protein Properties Length: 1879aa    MW: 208273 Da    PI: 6.7534
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT4G12020.3genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY93.31.8e-29467524159
                  ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
         WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                  ++DgynW+KYGqK+vkgs+fp sYY+Ct+ gCp+k+kvers  d++v ei+Y+++Hnhe
  AT4G12020.3 467 VNDGYNWQKYGQKKVKGSKFPLSYYKCTYLGCPSKRKVERSL-DGQVAEIVYKDRHNHE 524
                  58****************************************.***************8 PP

2WRKY33.58.4e-11640661122
                  ---SS-EEEEEEE--TT-SS-E CS
         WRKY   1 ldDgynWrKYGqKevkgsefpr 22 
                  ldDgy+WrKYGqK+vkg+++pr
  AT4G12020.3 640 LDDGYRWRKYGQKVVKGNPYPR 661
                  59*******************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5147714.353291371IPR003822Paired amphipathic helix
SuperFamilySSF477623.79E-17302370IPR003822Paired amphipathic helix
Gene3DG3DSA:1.20.1160.113.2E-15302370IPR003822Paired amphipathic helix
PfamPF026714.4E-12324368IPR003822Paired amphipathic helix
PROSITE profilePS5081121.207462526IPR003657WRKY domain
Gene3DG3DSA:2.20.25.804.5E-23463526IPR003657WRKY domain
SuperFamilySSF1182903.79E-21466526IPR003657WRKY domain
SMARTSM007741.9E-30467525IPR003657WRKY domain
PfamPF031062.6E-21468524IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.6E-12625661IPR003657WRKY domain
SuperFamilySSF1182907.72E-9632662IPR003657WRKY domain
PROSITE profilePS5081114.952635661IPR003657WRKY domain
SMARTSM007746.8E-6640689IPR003657WRKY domain
PfamPF031061.2E-6641661IPR003657WRKY domain
SuperFamilySSF522001.14E-9661785IPR000157Toll/interleukin-1 receptor homology (TIR) domain
SuperFamilySSF525403.08E-378011062IPR027417P-loop containing nucleoside triphosphate hydrolase
PfamPF009311.4E-178221030IPR002182NB-ARC
Gene3DG3DSA:3.40.50.3006.4E-9835973IPR027417P-loop containing nucleoside triphosphate hydrolase
PRINTSPR003641.3E-15839854No hitNo description
PRINTSPR003641.3E-15915929No hitNo description
SuperFamilySSF467858.16E-710411142IPR011991Winged helix-turn-helix DNA-binding domain
SuperFamilySSF520583.06E-4111601448IPR032675Leucine-rich repeat domain, L domain-like
Gene3DG3DSA:3.80.10.102.5E-3311661446IPR032675Leucine-rich repeat domain, L domain-like
PfamPF077252.3E-512281247IPR011713Leucine-rich repeat 3
PRINTSPR003641.3E-1513251341No hitNo description
Gene3DG3DSA:3.30.200.209.5E-2616221734No hitNo description
SuperFamilySSF561121.37E-6716241862IPR011009Protein kinase-like domain
PROSITE profilePS5001138.63316261861IPR000719Protein kinase domain
PfamPF000693.4E-5016271861IPR000719Protein kinase domain
Gene3DG3DSA:1.10.510.103.9E-3817351862No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0006468Biological Processprotein phosphorylation
GO:0006952Biological Processdefense response
GO:0007165Biological Processsignal transduction
GO:0005634Cellular Componentnucleus
GO:0009941Cellular Componentchloroplast envelope
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0004674Molecular Functionprotein serine/threonine kinase activity
GO:0005515Molecular Functionprotein binding
GO:0005524Molecular FunctionATP binding
GO:0043531Molecular FunctionADP binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001016developmental stageL mature pollen stage
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 1879 aa     Download sequence    Send to blast
MSEKEELPLT LTSIGAATAT SDYHQRVGSS GEGISSSSSD VDPRFMQNSP TGLMISQSSS  60
MCTVPPGMAA TPPISSGSGL SQQLNNSSSS KLCQVEGCQK GARDASGRCI SHGGGRRCQK  120
PDCQKGAEGK TVYCKAHGGG RRCEYLGCTK GAEGSTDFCI AHGGGRRCNH EDCTRSAWGR  180
TEFCVKHGGG ARCKTYGCGK SASGPLPFCR AHGGGKKCSH EDCTGFARGR SGLCLMHGGG  240
KRCQRENCTK SAEGLSGLCI SHGGGRRCQS IGCTKGAKGS KMFCKACITK RPLTIDGGGN  300
MGGVTTGDAL NYLKAVKDKF EDSEKYDTFL EVLNDCKHQG VDTSGVIARL KDLFKGHDDL  360
LLGFNTYLSK EYQITILPED DFPIDFLDKV EGPYEMTYQQ AQTVQANANM QPQTEYPSSS  420
AVQSFSSGQP QIPTSAPDSS LLAKSNTSGI TIIEHMSQQP LNVDKQVNDG YNWQKYGQKK  480
VKGSKFPLSY YKCTYLGCPS KRKVERSLDG QVAEIVYKDR HNHEPPNQGK DGSTTYLSGS  540
STHINCMSSE LTASQFSSNK TKIEQQEAAS LATTIEYMSE ASDNEEDSNG ETSEGEKDED  600
EPEPKRRITE VQVSELADAS DRTVREPRVI FQTTSEVDNL DDGYRWRKYG QKVVKGNPYP  660
RFSSSKDYDV VIRYGRADIS NEDFISHLRA SLCRRGISVY EKFNEVDALP KCRVLIIVLT  720
STYVPSNLLN ILEHQHTEDR VVYPIFYRLS PYDFVCNSKN YERFYLQDEP KKWQAALKEI  780
TQMPGYTLTD KSESELIDEI VRDALKVLCS ADKVNMIGMD MQVEEILSLL CIESLDVRSI  840
GIWGTVGIGK TTIAEEIFRK ISVQYETCVV LKDLHKEVEV KGHDAVRENF LSEVLEVEPH  900
VIRISDIKTS FLRSRLQRKR ILVILDDVND YRDVDTFLGT LNYFGPGSRI IMTSRNRRVF  960
VLCKIDHVYE VKPLDIPKSL LLLDRGTCQI VLSPEVYKTL SLELVKFSNG NPQVLQFLSS  1020
IDREWNKLSQ EVKTTSPIYI PGIFEKSCCG LDDNERGIFL DIACFFNRID KDNVAMLLDG  1080
CGFSAHVGFR GLVDKSLLTI SQHNLVDMLS FIQATGREIV RQESADRPGD RSRLWNADYI  1140
RHVFINDTGT SAIEGIFLDM LNLKFDANPN VFEKMCNLRL LKLYCSKAEE KHGVSFPQGL  1200
EYLPSKLRLL HWEYYPLSSL PKSFNPENLV ELNLPSSCAK KLWKGKKARF CTTNSSLEKL  1260
KKMRLSYSDQ LTKIPRLSSA TNLEHIDLEG CNSLLSLSQS ISYLKKLVFL NLKGCSKLEN  1320
IPSMVDLESL EVLNLSGCSK LGNFPEISPN VKELYMGGTM IQEIPSSIKN LVLLEKLDLE  1380
NSRHLKNLPT SIYKLKHLET LNLSGCISLE RFPDSSRRMK CLRFLDLSRT DIKELPSSIS  1440
YLTALDELLF VDSRRNSPVV TNPNANSTEL MPSESSKLEI LGTPADNEVV VGGTVEKTRG  1500
IERTPTILVK SREYLIPDDV VAVGGDIKGL RPPVLQLQPA MKLSHIPRGS TWDFVTHFAP  1560
PETVAPPSSS SEAREEEVET EETGAMFIPL GDKETCSFTV NKGDSSRTIS NTSPIYASEG  1620
SFITCWQKGQ LLGRGSLGSV YEGISADGDF FAFKEVSLLD QGSQAHEWIQ QVEGGIALLS  1680
QLQHQNIVRY RGTTKDESNL YIFLELVTQG SLRKLYQRNQ LGDSVVSLYT RQILDGLKYL  1740
HDKGFIHRNI KCANVLVDAN GTVKLADFGL AKVILNPKDY DGYGTPADIW SLGCTVLEML  1800
TGQIPYSDLE IGTALYNIGT GKLPKIPDIL SLDARDFILT CLKVNPEERP TAAELLNHPF  1860
VNMPLPSSGS GSVSSLLRG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2clq_A3e-401631186329284MITOGEN-ACTIVATED PROTEIN KINASE KINASE KINAS
2clq_B3e-401631186329284MITOGEN-ACTIVATED PROTEIN KINASE KINASE KINAS
4bib_A4e-401631186326281MITOGEN-ACTIVATED PROTEIN KINASE KINASE KINAS
4bib_B4e-401631186326281MITOGEN-ACTIVATED PROTEIN KINASE KINASE KINAS
4bic_A4e-401631186326281MITOGEN-ACTIVATED PROTEIN KINASE KINASE KINAS
4bic_B4e-401631186326281MITOGEN-ACTIVATED PROTEIN KINASE KINASE KINAS
4bid_A4e-401631186326281MITOGEN-ACTIVATED PROTEIN KINASE KINASE KINAS
4bid_B4e-401631186326281MITOGEN-ACTIVATED PROTEIN KINASE KINASE KINAS
4bie_A4e-401631186326281MITOGEN-ACTIVATED PROTEIN KINASE KINASE KINAS
4bie_B4e-401631186326281MITOGEN-ACTIVATED PROTEIN KINASE KINASE KINAS
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.30760.0leaf| root
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible254852_at1e-162
Expression AtlasAT4G12020-
AtGenExpressAT4G12020-
Functional Description ? help Back to Top
Source Description
TAIREncodes a member of the A1 subgroup of the MEKK (MAPK/ERK kinase kinase) family. MEKK is another name for Mitogen-Activated Protein Kinase Kinase Kinase (MAPKKK or MAP3K). This subgroup has four members: At4g08500 (MEKK1, also known as ARAKIN, MAP3Kb1, MAPKKK8), At4g08480 (MEKK2, also known as MAP3Kb4, MAPKKK9), At4g08470 (MEKK3, also known as MAP3Kb3, MAPKKK10) and At4g12020 (MEKK4, also known as MAP3Kb5, MAPKKK11, WRKY19). Nomenclatures for mitogen-activated protein kinases are described in Trends in Plant Science 2002,7(7):301.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT4G12020.3
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT4G12020
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0026870.0CP002687.1 Arabidopsis thaliana chromosome 4 sequence.
GenBankAL1615330.0AL161533.2 Arabidopsis thaliana DNA chromosome 4, contig fragment No. 33.
GenBankAL0496380.0AL049638.1 Arabidopsis thaliana DNA chromosome 4, BAC clone F16J13 (ESSA project).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001154222.10.0mitogen-activated protein kinase kinase kinase 11
SwissprotQ9SZ670.0WRK19_ARATH; Probable WRKY transcription factor 19
TrEMBLF4JPV90.0F4JPV9_ARATH; Mitogen-activated protein kinase kinase kinase 11
STRINGAT4G12020.20.0(Arabidopsis thaliana)
Publications ? help Back to Top
  1. Eulgem T,Rushton PJ,Robatzek S,Somssich IE
    The WRKY superfamily of plant transcription factors.
    Trends Plant Sci., 2000. 5(5): p. 199-206
    [PMID:10785665]
  2. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  3. MAPK Group
    Mitogen-activated protein kinase cascades in plants: a new nomenclature.
    Trends Plant Sci., 2002. 7(7): p. 301-8
    [PMID:12119167]
  4. Jonak C,Okr
    Complexity, cross talk and integration of plant MAP kinase signalling.
    Curr. Opin. Plant Biol., 2002. 5(5): p. 415-24
    [PMID:12183180]
  5. Meyers BC,Kozik A,Griego A,Kuang H,Michelmore RW
    Genome-wide analysis of NBS-LRR-encoding genes in Arabidopsis.
    Plant Cell, 2003. 15(4): p. 809-34
    [PMID:12671079]
  6. Shiu SH,Bleecker AB
    Expansion of the receptor-like kinase/Pelle gene family and receptor-like proteins in Arabidopsis.
    Plant Physiol., 2003. 132(2): p. 530-43
    [PMID:12805585]
  7. Froehlich JE, et al.
    Proteomic study of the Arabidopsis thaliana chloroplastic envelope membrane utilizing alternatives to traditional two-dimensional electrophoresis.
    J. Proteome Res., 2003 Jul-Aug. 2(4): p. 413-25
    [PMID:12938931]
  8. Ko JH,Han KH,Park S,Yang J
    Plant body weight-induced secondary growth in Arabidopsis and its transcription phenotype revealed by whole-transcriptome profiling.
    Plant Physiol., 2004. 135(2): p. 1069-83
    [PMID:15194820]
  9. Noutoshi Y, et al.
    A single amino acid insertion in the WRKY domain of the Arabidopsis TIR-NBS-LRR-WRKY-type disease resistance protein SLH1 (sensitive to low humidity 1) causes activation of defense responses and hypersensitive cell death.
    Plant J., 2005. 43(6): p. 873-88
    [PMID:16146526]
  10. Tan X, et al.
    Global expression analysis of nucleotide binding site-leucine rich repeat-encoding and related genes in Arabidopsis.
    BMC Plant Biol., 2007. 7: p. 56
    [PMID:17956627]
  11. Chang IF, et al.
    Proteomic profiling of tandem affinity purified 14-3-3 protein complexes in Arabidopsis thaliana.
    Proteomics, 2009. 9(11): p. 2967-85
    [PMID:19452453]