PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT4G10350.1
Common NameANAC070, BRN2, F24G24.150, NAC070
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family NAC
Protein Properties Length: 341aa    MW: 38946.4 Da    PI: 7.2593
Description NAC domain containing protein 70
Gene Model
Gene Model ID Type Source Coding Sequence
AT4G10350.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM172.99.5e-5491381129
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvka...eekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                  +ppGfrFhPtdeel+++yLkkk++ +k+e+ evi+evd++k+ePwdL++++k     ++ewyfFs++d+ky+tg+r+nrat++g+Wkatg+dk + + 
  AT4G10350.1   9 VPPGFRFHPTDEELLHYYLKKKISYQKFEM-EVIREVDLNKLEPWDLQERCKIgstPQNEWYFFSHKDRKYPTGSRTNRATHAGFWKATGRDKCIRN- 104
                  69****************************.99**************964444222455*************************************9. PP

          NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrle 129
                  + +++g++ktLvfykgrap+g+ktdW+mheyrle
  AT4G10350.1 105 SYKKIGMRKTLVFYKGRAPHGQKTDWIMHEYRLE 138
                  8999****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.22E-608160IPR003441NAC domain
PROSITE profilePS5100558.0729160IPR003441NAC domain
PfamPF023655.5E-2810137IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009834Biological Processplant-type secondary cell wall biogenesis
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048829Biological Processroot cap development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000035anatomycotyledon vascular system
PO:0009005anatomyroot
PO:0020131anatomylateral root cap
PO:0020132anatomycolumella root cap cell
Sequence ? help Back to Top
Protein Sequence    Length: 341 aa     Download sequence    Send to blast
MGSSSNGGVP PGFRFHPTDE ELLHYYLKKK ISYQKFEMEV IREVDLNKLE PWDLQERCKI  60
GSTPQNEWYF FSHKDRKYPT GSRTNRATHA GFWKATGRDK CIRNSYKKIG MRKTLVFYKG  120
RAPHGQKTDW IMHEYRLEDA DDPQANPSED GWVVCRVFMK KNLFKVVNEG SSSINSLDQH  180
NHDASNNNHA LQARSFMHRD SPYQLVRNHG AMTFELNKPD LALHQYPPIF HKPPSLGFDY  240
SSGLARDSES AASEGLQYQQ ACEPGLDVGT CETVASHNHQ QGLGEWAMMD RLVTCHMGNE  300
DSSRGITYED GNNNSSSVVQ PVPATNQLTL RSEMDFWGYS K
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A2e-51916215170Stress-induced transcription factor NAC1
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO306814150.0
Genevisible255022_at0.0
Expression AtlasAT4G10350-
AtGenExpressAT4G10350-
ATTED-IIAT4G10350-
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Detectable in lateral root development when they reach 10 mm long. {ECO:0000269|PubMed:20197506}.
UniprotTISSUE SPECIFICITY: Expressed throughout the root cap, in both columella (COL) and lateral root cap (LRC) cells, with higher levels in the COL-adjoining LRC than the upper LRC. Also present at low levels expression in the tips of cotyledons and the cotyledon vasculature, as weel as in vasculature of the first pair of true leaves and at the hydathodes. {ECO:0000269|PubMed:20197506}.
Functional Description ? help Back to Top
Source Description
TAIRNAC domain protein. SMB, BRN1, and BRN2 act to regulate root cap maturation, in a partially redundant fashion.BRN1 and BRN2, control the cell wall maturation processes that are required to detach root cap layers from the root.
UniProtTranscription activator. Together with BRN1 and SMB, regulates cellular maturation of root cap. Promotes the expression of genes involved in secondary cell walls (SCW) biosynthesis. {ECO:0000269|PubMed:20197506}.
Function -- GeneRIF ? help Back to Top
  1. SMB, BRN1, and BRN2, which are members of the Class IIB NAC transcription factor family, act redundantly to drive cellular differentiation and promote maturation of the root cap and the cell wall separations needed to produce a functional root cap.
    [PMID: 20197506]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00431DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT4G10350.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT4G10350
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY1336810.0AY133681.1 Arabidopsis thaliana clone C103095 putative NAM/NAP (At4g10350) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_192773.10.0protein BEARSKIN 2
SwissprotQ9SV870.0BRN2_ARATH; Protein BEARSKIN2
TrEMBLD7LY430.0D7LY43_ARALL; Predicted protein
STRINGAT4G10350.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1715800
MalvidsOGEM52132648
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  3. Ooka H, et al.
    Comprehensive analysis of NAC family genes in Oryza sativa and Arabidopsis thaliana.
    DNA Res., 2003. 10(6): p. 239-47
    [PMID:15029955]
  4. Czechowski T,Bari RP,Stitt M,Scheible WR,Udvardi MK
    Real-time RT-PCR profiling of over 1400 Arabidopsis transcription factors: unprecedented sensitivity reveals novel root- and shoot-specific genes.
    Plant J., 2004. 38(2): p. 366-79
    [PMID:15078338]
  5. Albert VA, et al.
    Floral gene resources from basal angiosperms for comparative genomics research.
    BMC Plant Biol., 2005. 5: p. 5
    [PMID:15799777]
  6. Bennett T, et al.
    SOMBRERO, BEARSKIN1, and BEARSKIN2 regulate root cap maturation in Arabidopsis.
    Plant Cell, 2010. 22(3): p. 640-54
    [PMID:20197506]
  7. Sun SB,Meng LS,Sun XD,Feng ZH
    Using high competent shoot apical meristems of cockscomb as explants for studying function of ASYMMETRIC LEAVES2-LIKE11 (ASL11) gene of Arabidopsis.
    Mol. Biol. Rep., 2010. 37(8): p. 3973-82
    [PMID:20306306]