PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT4G08150.1
Common NameBP, BP1, F9M13.2, KNAT1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family TALE
Protein Properties Length: 398aa    MW: 45835.6 Da    PI: 6.4671
Description KNOTTED-like from Arabidopsis thaliana
Gene Model
Gene Model ID Type Source Coding Sequence
AT4G08150.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.62.4e-093243592055
                  HHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
     Homeobox  20 eknrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                  +k +yps++e+  LA+++gL+++q+ +WF N+R ++
  AT4G08150.1 324 YKWPYPSESEKVALAESTGLDQKQINNWFINQRKRH 359
                  5679*****************************885 PP

2ELK35.91.6e-12279300122
          ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                  ELK++Ll+KYsgyL+sLkqE+s
  AT4G08150.1 279 ELKNHLLKKYSGYLSSLKQELS 300
                  9*******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012556.1E-23132176IPR005540KNOX1
PfamPF037902.1E-22133174IPR005540KNOX1
SMARTSM012566.5E-31184235IPR005541KNOX2
PfamPF037917.9E-26189234IPR005541KNOX2
PfamPF037897.9E-10279300IPR005539ELK domain
PROSITE profilePS5121311.243279299IPR005539ELK domain
SMARTSM011881.0E-6279300IPR005539ELK domain
PROSITE profilePS5007113.021299362IPR001356Homeobox domain
SuperFamilySSF466891.41E-19300374IPR009057Homeodomain-like
SMARTSM003894.0E-13301366IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.9E-27304365IPR009057Homeodomain-like
CDDcd000861.73E-11311363No hitNo description
PfamPF059201.2E-16319358IPR008422Homeobox KN domain
PROSITE patternPS000270337360IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001708Biological Processcell fate specification
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010051Biological Processxylem and phloem pattern formation
GO:0010089Biological Processxylem development
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005515Molecular Functionprotein binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000223anatomyshoot axis cortex
PO:0000225anatomyperipheral zone
PO:0000226anatomyrib zone
PO:0000230anatomyinflorescence meristem
PO:0004721anatomyparaclade cortex
PO:0004722anatomypedicel cortex
PO:0005022anatomyovary wall
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009052anatomyflower pedicel
PO:0009074anatomystyle
PO:0020100anatomyhypocotyl
PO:0025022anatomycollective leaf structure
PO:0025272anatomyovary replum
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 398 aa     Download sequence    Send to blast
MEEYQHDNST TPQRVSFLYS PISSSNKNDN TSDTNNNNNN NNSSNYGPGY NNTNNNNHHH  60
QHMLFPHMSS LLPQTTENCF RSDHDQPNNN NNPSVKSEAS SSRINHYSML MRAIHNTQEA  120
NNNNNDNVSD VEAMKAKIIA HPHYSTLLQA YLDCQKIGAP PDVVDRITAA RQDFEARQQR  180
STPSVSASSR DPELDQFMEA YCDMLVKYRE ELTRPIQEAM EFIRRIESQL SMLCQSPIHI  240
LNNPDGKSDN MGSSDEEQEN NSGGETELPE IDPRAEDREL KNHLLKKYSG YLSSLKQELS  300
KKKKKGKLPK EARQKLLTWW ELHYKWPYPS ESEKVALAES TGLDQKQINN WFINQRKRHW  360
KPSEDMQFMV MDGLQHPHHA ALYMDGHYMG DGPYRLGP
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.280600.0root| seed| silique
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO306806490.0
Genevisible255149_at0.0
Expression AtlasAT4G08150-
AtGenExpressAT4G08150-
ATTED-IIAT4G08150-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in the vegetative meristem. {ECO:0000269|PubMed:12900451, ECO:0000269|PubMed:7866029}.
Functional Description ? help Back to Top
Source Description
TAIRA member of class I knotted1-like homeobox gene family (together with KNAT2). Similar to the knotted1 (kn1) homeobox gene of maize. Normally expressed in the peripheral and rib zone of shoot apical meristem but not in the leaf primordia. It is also expressed in the fourth floral whorl, in the region that would become style, particularly in the cell surrounding the transmitting tissue. No expression was detected in the first three floral whorls. Expression is repressed by auxin and AS1 which results in the promotion of leaf fate.
UniProtMay play a role in meristem function, and may be involved in maintaining cells in an undifferentiated, meristematic state, and its expression disappears at the same time the shoot apex undergoes the transition from vegetative to reproductive development (PubMed:11934861). Positive regulator of LATERAL ORGAN BOUNDARIES (LOB) (PubMed:11934861). Probably binds to the DNA sequence 5'-TGAC-3' (PubMed:11934861). Able to traffic from the L1 to the L2/L3 layers of the meristem, presumably through plasmodesmata (PubMed:12900451). {ECO:0000269|PubMed:11934861, ECO:0000269|PubMed:12900451, ECO:0000269|PubMed:7866029}.
Function -- GeneRIF ? help Back to Top
  1. Heterodimers with PENNYWISE or POUND-FOOLISH are essential for establishing early internode patterning events.
    [PMID: 16741748]
  2. data showed that BP and PNY restrict KNAT6 and KNAT2 expression to promote correct inflorescence development
    [PMID: 18390591]
  3. Expression of KNAT1 in the integuments leads to extra cell divisions in the outer layer of the outer integument, and being compensated for by a decrease of cell volume, thus showing that mechanisms exist to control proper ovule integument morphogenesis.
    [PMID: 18410683]
  4. Results suggested that the late-flowering phenotype of the as1-1 and as2-1 mutants might have been caused by the ectopic expression of KNAT126 triple mutation.
    [PMID: 19891706]
  5. Results indicate that BP/KNAT1 acts as a negative regulator and KNAT2 and KNAT6 act as positive regulators of floral organ separation in the IDA-HAE/HSL2 signaling cascade.
    [PMID: 21742991]
  6. The data indicate that the ATH1-KNAT2 complex acts redundantly with KNAT6, both of which are negatively regulated by BP during pedicel development.
    [PMID: 22140242]
  7. Arabidopsis ASYMMETRIC LEAVES complex physically interacts with PRC2 and recruits this complex to the homeobox genes BREVIPEDICELLUS and KNAT2 to stably silence these stem cell regulators in differentiating leaves.
    [PMID: 23468429]
  8. This function of STM in meristem establishment and organisation can be replaced by KNAT1/BP, but not KNAT2.
    [PMID: 23573875]
  9. KNAT1 negatively modulates root skewing, possibly by regulating auxin transport
    [PMID: 23889705]
  10. NTT loss of function leads to reduced replum width and cell number, whereas increased expression promotes replum enlargement. NTT activates the homeobox gene BP, which, together with RPL, is important for replum development.
    [PMID: 25039392]
  11. In the cambium, KNAT1 and STM, contrary to their function in the shoot apical meristem, promote cell differentiation through repression of BOP genes.
    [PMID: 25371365]
  12. Arabidopsis plants harboring loss-of-function KNOX2 alleles exhibit impaired differentiation of all aerial organs and have highly complex leaves, phenocopying gain-of-function KNOX1 alleles.
    [PMID: 25671434]
  13. our results indicate that BP interacts with the chromatin remodeling factor BRM to regulate the expression of KNAT2 and KNAT6 in control of inflorescence architecture.
    [PMID: 25822547]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT4G08150.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Negatively regulated by ASYMMETRIC LEAVES1 (AS1) and ASYMMETRIC LEAVES2 (AS2).
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- ATRM (Manually Curated Upstream Regulators) ? help Back to Top
Source Upstream Regulator (A: Activate/R: Repress)
ATRM AT1G65620 (R), AT2G23760 (R), AT2G37630 (R), AT4G00220 (A), AT4G08150 (A), AT4G36870 (R), AT5G02030 (A), AT5G66870 (R)
Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top
Source Target Gene (A: Activate/R: Repress)
ATRM AT4G08150(A), AT4G25420(R), AT5G63090(A)
Regulation -- Hormone ? help Back to Top
Source Hormone
AHDGibberellin
Interaction -- BIND ? help Back to Top
Source Intact With Description
BINDAT5G02030PNY interacts with BP.
Interaction ? help Back to Top
Source Intact With
BioGRIDAT4G32980, AT4G34610, AT4G36870, AT5G11060, AT5G02030, AT5G41410, AT1G62990, AT1G75410, AT1G77950
IntActSearch P46639
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT4G08150
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY1139820.0AY113982.1 Arabidopsis thaliana putative KNAT1 homeobox protein (At4g08150) mRNA, complete cds.
GenBankAY0808340.0AY080834.1 Arabidopsis thaliana putative KNAT1 homeobox protein (At4g08150) mRNA, complete cds.
GenBankATU141740.0U14174.1 Arabidopsis thaliana clone KNAT1 knotted-like homeobox protein gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_192555.10.0homeobox protein knotted-1-like 1
SwissprotP466390.0KNAT1_ARATH; Homeobox protein knotted-1-like 1
TrEMBLR0FIH20.0R0FIH2_9BRAS; Uncharacterized protein
STRINGAT4G08150.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP16717148
MalvidsOGEM65662335
Publications ? help Back to Top
  1. Rupp HM,Frank M,Werner T,Strnad M,Schm
    Increased steady state mRNA levels of the STM and KNAT1 homeobox genes in cytokinin overproducing Arabidopsis thaliana indicate a role for cytokinins in the shoot apical meristem.
    Plant J., 1999. 18(5): p. 557-63
    [PMID:10417706]
  2. Frank M, et al.
    Hormone autotrophic growth and differentiation identifies mutant lines of Arabidopsis with altered cytokinin and auxin content or signaling.
    Plant Physiol., 2000. 122(3): p. 721-9
    [PMID:10712535]
  3. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  4. Byrne ME, et al.
    Asymmetric leaves1 mediates leaf patterning and stem cell function in Arabidopsis.
    Nature, 2000 Dec 21-28. 408(6815): p. 967-71
    [PMID:11140682]
  5. Semiarti E, et al.
    The ASYMMETRIC LEAVES2 gene of Arabidopsis thaliana regulates formation of a symmetric lamina, establishment of venation and repression of meristem-related homeobox genes in leaves.
    Development, 2001. 128(10): p. 1771-83
    [PMID:11311158]
  6. Pautot V, et al.
    KNAT2: evidence for a link between knotted-like genes and carpel development.
    Plant Cell, 2001. 13(8): p. 1719-34
    [PMID:11487688]
  7. Frugis G, et al.
    Overexpression of KNAT1 in lettuce shifts leaf determinate growth to a shoot-like indeterminate growth associated with an accumulation of isopentenyl-type cytokinins.
    Plant Physiol., 2001. 126(4): p. 1370-80
    [PMID:11500537]
  8. Bellaoui M, et al.
    The Arabidopsis BELL1 and KNOX TALE homeodomain proteins interact through a domain conserved between plants and animals.
    Plant Cell, 2001. 13(11): p. 2455-70
    [PMID:11701881]
  9. Douglas SJ,Chuck G,Dengler RE,Pelecanda L,Riggs CD
    KNAT1 and ERECTA regulate inflorescence architecture in Arabidopsis.
    Plant Cell, 2002. 14(3): p. 547-58
    [PMID:11910003]
  10. Venglat SP, et al.
    The homeobox gene BREVIPEDICELLUS is a key regulator of inflorescence architecture in Arabidopsis.
    Proc. Natl. Acad. Sci. U.S.A., 2002. 99(7): p. 4730-5
    [PMID:11917137]
  11. Byrne ME,Simorowski J,Martienssen RA
    ASYMMETRIC LEAVES1 reveals knox gene redundancy in Arabidopsis.
    Development, 2002. 129(8): p. 1957-65
    [PMID:11934861]
  12. Long JA,Woody S,Poethig S,Meyerowitz EM,Barton MK
    Transformation of shoots into roots in Arabidopsis embryos mutant at the TOPLESS locus.
    Development, 2002. 129(12): p. 2797-806
    [PMID:12050130]
  13. Frank M, et al.
    Tumorous shoot development (TSD) genes are required for co-ordinated plant shoot development.
    Plant J., 2002. 29(1): p. 73-85
    [PMID:12060228]
  14. Hay A, et al.
    The gibberellin pathway mediates KNOTTED1-type homeobox function in plants with different body plans.
    Curr. Biol., 2002. 12(18): p. 1557-65
    [PMID:12372247]
  15. Ha CM, et al.
    The BLADE-ON-PETIOLE 1 gene controls leaf pattern formation through the modulation of meristematic activity in Arabidopsis.
    Development, 2003. 130(1): p. 161-72
    [PMID:12441300]
  16. Curaba J,Herzog M,Vachon G
    GeBP, the first member of a new gene family in Arabidopsis, encodes a nuclear protein with DNA-binding activity and is regulated by KNAT1.
    Plant J., 2003. 33(2): p. 305-17
    [PMID:12535344]
  17. Theodoris G,Inada N,Freeling M
    Conservation and molecular dissection of ROUGH SHEATH2 and ASYMMETRIC LEAVES1 function in leaf development.
    Proc. Natl. Acad. Sci. U.S.A., 2003. 100(11): p. 6837-42
    [PMID:12750468]
  18. Nakazawa M, et al.
    Activation tagging, a novel tool to dissect the functions of a gene family.
    Plant J., 2003. 34(5): p. 741-50
    [PMID:12787254]
  19. Smith HM,Hake S
    The interaction of two homeobox genes, BREVIPEDICELLUS and PENNYWISE, regulates internode patterning in the Arabidopsis inflorescence.
    Plant Cell, 2003. 15(8): p. 1717-27
    [PMID:12897247]
  20. Kim JY,Yuan Z,Jackson D
    Developmental regulation and significance of KNOX protein trafficking in Arabidopsis.
    Development, 2003. 130(18): p. 4351-62
    [PMID:12900451]
  21. Mele G,Ori N,Sato Y,Hake S
    The knotted1-like homeobox gene BREVIPEDICELLUS regulates cell differentiation by modulating metabolic pathways.
    Genes Dev., 2003. 17(17): p. 2088-93
    [PMID:12923061]
  22. Lin WC,Shuai B,Springer PS
    The Arabidopsis LATERAL ORGAN BOUNDARIES-domain gene ASYMMETRIC LEAVES2 functions in the repression of KNOX gene expression and in adaxial-abaxial patterning.
    Plant Cell, 2003. 15(10): p. 2241-52
    [PMID:14508003]
  23. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  24. Hibara K,Takada S,Tasaka M
    CUC1 gene activates the expression of SAM-related genes to induce adventitious shoot formation.
    Plant J., 2003. 36(5): p. 687-96
    [PMID:14617069]
  25. Yang S,Yu H,Xu Y,Goh CJ
    Investigation of cytokinin-deficient phenotypes in Arabidopsis by ectopic expression of orchid DSCKX1.
    FEBS Lett., 2003. 555(2): p. 291-6
    [PMID:14644430]
  26. Katz A,Oliva M,Mosquna A,Hakim O,Ohad N
    FIE and CURLY LEAF polycomb proteins interact in the regulation of homeobox gene expression during sporophyte development.
    Plant J., 2004. 37(5): p. 707-19
    [PMID:14871310]
  27. Bhatt AM,Etchells JP,Canales C,Lagodienko A,Dickinson H
    VAAMANA--a BEL1-like homeodomain protein, interacts with KNOX proteins BP and STM and regulates inflorescence stem growth in Arabidopsis.
    Gene, 2004. 328: p. 103-11
    [PMID:15019989]
  28. Hackbusch J,Richter K,Müller J,Salamini F,Uhrig JF
    A central role of Arabidopsis thaliana ovate family proteins in networking and subcellular localization of 3-aa loop extension homeodomain proteins.
    Proc. Natl. Acad. Sci. U.S.A., 2005. 102(13): p. 4908-12
    [PMID:15781858]
  29. Chalfun-Junior A, et al.
    ASYMMETRIC LEAVES2-LIKE1 gene, a member of the AS2/LOB family, controls proximal-distal patterning in Arabidopsis petals.
    Plant Mol. Biol., 2005. 57(4): p. 559-75
    [PMID:15821980]
  30. Kwon CS,Chen C,Wagner D
    WUSCHEL is a primary target for transcriptional regulation by SPLAYED in dynamic control of stem cell fate in Arabidopsis.
    Genes Dev., 2005. 19(8): p. 992-1003
    [PMID:15833920]
  31. Li H, et al.
    The Putative RNA-dependent RNA polymerase RDR6 acts synergistically with ASYMMETRIC LEAVES1 and 2 to repress BREVIPEDICELLUS and MicroRNA165/166 in Arabidopsis leaf development.
    Plant Cell, 2005. 17(8): p. 2157-71
    [PMID:16006579]
  32. Douglas SJ,Riggs CD
    Pedicel development in Arabidopsis thaliana: contribution of vascular positioning and the role of the BREVIPEDICELLUS and ERECTA genes.
    Dev. Biol., 2005. 284(2): p. 451-63
    [PMID:16038894]
  33. Ledbedeva OV,Ezhova TA,Melzer S
    [Gene TAENIATA is a novel negative regulator of the Arabidopsis thaliana homeobox genes KNAT1, KNAT2, KNAT6, and STM].
    Genetika, 2005. 41(8): p. 1068-74
    [PMID:16161627]
  34. Chua YL,Channeli
    The bromodomain protein GTE6 controls leaf development in Arabidopsis by histone acetylation at ASYMMETRIC LEAVES1.
    Genes Dev., 2005. 19(18): p. 2245-54
    [PMID:16166385]
  35. Grigg SP,Canales C,Hay A,Tsiantis M
    SERRATE coordinates shoot meristem function and leaf axial patterning in Arabidopsis.
    Nature, 2005. 437(7061): p. 1022-6
    [PMID:16222298]
  36. Truernit E,Siemering KR,Hodge S,Grbic V,Haseloff J
    A map of KNAT gene expression in the Arabidopsis root.
    Plant Mol. Biol., 2006. 60(1): p. 1-20
    [PMID:16463096]
  37. Cole M,Nolte C,Werr W
    Nuclear import of the transcription factor SHOOT MERISTEMLESS depends on heterodimerization with BLH proteins expressed in discrete sub-domains of the shoot apical meristem of Arabidopsis thaliana.
    Nucleic Acids Res., 2006. 34(4): p. 1281-92
    [PMID:16513846]
  38. Kanrar S,Onguka O,Smith HM
    Arabidopsis inflorescence architecture requires the activities of KNOX-BELL homeodomain heterodimers.
    Planta, 2006. 224(5): p. 1163-73
    [PMID:16741748]
  39. Hay A,Barkoulas M,Tsiantis M
    ASYMMETRIC LEAVES1 and auxin activities converge to repress BREVIPEDICELLUS expression and promote leaf development in Arabidopsis.
    Development, 2006. 133(20): p. 3955-61
    [PMID:16971475]
  40. Okushima Y,Fukaki H,Onoda M,Theologis A,Tasaka M
    ARF7 and ARF19 regulate lateral root formation via direct activation of LBD/ASL genes in Arabidopsis.
    Plant Cell, 2007. 19(1): p. 118-30
    [PMID:17259263]
  41. Krupkov
    The TUMOROUS SHOOT DEVELOPMENT2 gene of Arabidopsis encoding a putative methyltransferase is required for cell adhesion and co-ordinated plant development.
    Plant J., 2007. 50(4): p. 735-50
    [PMID:17461780]
  42. Wang S,Chang Y,Guo J,Chen JG
    Arabidopsis Ovate Family Protein 1 is a transcriptional repressor that suppresses cell elongation.
    Plant J., 2007. 50(5): p. 858-72
    [PMID:17461792]
  43. Borghi L,Bureau M,Simon R
    Arabidopsis JAGGED LATERAL ORGANS is expressed in boundaries and coordinates KNOX and PIN activity.
    Plant Cell, 2007. 19(6): p. 1795-808
    [PMID:17557810]
  44. Alonso-Cantabrana H, et al.
    Common regulatory networks in leaf and fruit patterning revealed by mutations in the Arabidopsis ASYMMETRIC LEAVES1 gene.
    Development, 2007. 134(14): p. 2663-71
    [PMID:17592013]
  45. Kumar R, et al.
    The Arabidopsis BEL1-LIKE HOMEODOMAIN proteins SAW1 and SAW2 act redundantly to regulate KNOX expression spatially in leaf margins.
    Plant Cell, 2007. 19(9): p. 2719-35
    [PMID:17873098]
  46. Soucek P,Kl
    Involvement of hormones and KNOXI genes in early Arabidopsis seedling development.
    J. Exp. Bot., 2007. 58(13): p. 3797-810
    [PMID:17951601]
  47. Depuydt S, et al.
    Modulation of the hormone setting by Rhodococcus fascians results in ectopic KNOX activation in Arabidopsis.
    Plant Physiol., 2008. 146(3): p. 1267-81
    [PMID:18184732]
  48. Guo M,Thomas J,Collins G,Timmermans MC
    Direct repression of KNOX loci by the ASYMMETRIC LEAVES1 complex of Arabidopsis.
    Plant Cell, 2008. 20(1): p. 48-58
    [PMID:18203921]
  49. Tanaka M,Kato N,Nakayama H,Nakatani M,Takahata Y
    Expression of class I knotted1-like homeobox genes in the storage roots of sweetpotato (Ipomoea batatas).
    J. Plant Physiol., 2008. 165(16): p. 1726-35
    [PMID:18242774]
  50. Testone G, et al.
    Peach [Prunus persica (L.) Batsch] KNOPE1, a class 1 KNOX orthologue to Arabidopsis BREVIPEDICELLUS/KNAT1, is misexpressed during hyperplasia of leaf curl disease.
    J. Exp. Bot., 2008. 59(2): p. 389-402
    [PMID:18250078]
  51. Di Giacomo E, et al.
    Characterization of KNOX genes in Medicago truncatula.
    Plant Mol. Biol., 2008. 67(1-2): p. 135-50
    [PMID:18274864]
  52. Ragni L,Belles-Boix E,Günl M,Pautot V
    Interaction of KNAT6 and KNAT2 with BREVIPEDICELLUS and PENNYWISE in Arabidopsis inflorescences.
    Plant Cell, 2008. 20(4): p. 888-900
    [PMID:18390591]
  53. Magnani E,Hake S
    KNOX lost the OX: the Arabidopsis KNATM gene defines a novel class of KNOX transcriptional regulators missing the homeodomain.
    Plant Cell, 2008. 20(4): p. 875-87
    [PMID:18398054]
  54. Truernit E,Haseloff J
    Arabidopsis thaliana outer ovule integument morphogenesis: ectopic expression of KNAT1 reveals a compensation mechanism.
    BMC Plant Biol., 2008. 8: p. 35
    [PMID:18410683]
  55. Kimura S,Koenig D,Kang J,Yoong FY,Sinha N
    Natural variation in leaf morphology results from mutation of a novel KNOX gene.
    Curr. Biol., 2008. 18(9): p. 672-7
    [PMID:18424140]
  56. Soyano T,Thitamadee S,Machida Y,Chua NH
    ASYMMETRIC LEAVES2-LIKE19/LATERAL ORGAN BOUNDARIES DOMAIN30 and ASL20/LBD18 regulate tracheary element differentiation in Arabidopsis.
    Plant Cell, 2008. 20(12): p. 3359-73
    [PMID:19088331]
  57. Graciet E, et al.
    The N-end rule pathway controls multiple functions during Arabidopsis shoot and leaf development.
    Proc. Natl. Acad. Sci. U.S.A., 2009. 106(32): p. 13618-23
    [PMID:19620738]
  58. Scofield S,Dewitte W,Murray JA
    A model for Arabidopsis class-1 KNOX gene function.
    Plant Signal Behav, 2008. 3(4): p. 257-9
    [PMID:19704647]
  59. Bureau M,Simon R
    JLO regulates embryo patterning and organ initiation by controlling auxin transport.
    Plant Signal Behav, 2008. 3(2): p. 145-7
    [PMID:19704738]
  60. Larue CT,Wen J,Walker JC
    Genetic interactions between the miRNA164-CUC2 regulatory module and BREVIPEDICELLUS in Arabidopsis developmental patterning.
    Plant Signal Behav, 2009. 4(7): p. 666-8
    [PMID:19820320]
  61. Ikezaki M, et al.
    Genetic networks regulated by ASYMMETRIC LEAVES1 (AS1) and AS2 in leaf development in Arabidopsis thaliana: KNOX genes control five morphological events.
    Plant J., 2010. 61(1): p. 70-82
    [PMID:19891706]
  62. Wei N, et al.
    Changes in gravitational forces induce the modification of Arabidopsis thaliana silique pedicel positioning.
    J. Exp. Bot., 2010. 61(14): p. 3875-84
    [PMID:20603285]
  63. Abraham-Ju
    Class I KNOX genes are associated with organogenesis during bulbil formation in Agave tequilana.
    J. Exp. Bot., 2010. 61(14): p. 4055-67
    [PMID:20627900]
  64. Hanada K, et al.
    Functional compensation of primary and secondary metabolites by duplicate genes in Arabidopsis thaliana.
    Mol. Biol. Evol., 2011. 28(1): p. 377-82
    [PMID:20736450]
  65. Li H,Luan S
    The cyclophilin AtCYP71 interacts with CAF-1 and LHP1 and functions in multiple chromatin remodeling processes.
    Mol Plant, 2011. 4(4): p. 748-58
    [PMID:21596687]
  66. Shi CL, et al.
    Arabidopsis class I KNOTTED-like homeobox proteins act downstream in the IDA-HAE/HSL2 floral abscission signaling pathway.
    Plant Cell, 2011. 23(7): p. 2553-67
    [PMID:21742991]
  67. Arabidopsis Interactome Mapping Consortium
    Evidence for network evolution in an Arabidopsis interactome map.
    Science, 2011. 333(6042): p. 601-7
    [PMID:21798944]
  68. Xu XM, et al.
    Chaperonins facilitate KNOTTED1 cell-to-cell trafficking and stem cell function.
    Science, 2011. 333(6046): p. 1141-4
    [PMID:21868675]
  69. Yamaguchi N,Yamaguchi A,Abe M,Wagner D,Komeda Y
    LEAFY controls Arabidopsis pedicel length and orientation by affecting adaxial-abaxial cell fate.
    Plant J., 2012. 69(5): p. 844-56
    [PMID:22050454]
  70. Khan M, et al.
    Antagonistic interaction of BLADE-ON-PETIOLE1 and 2 with BREVIPEDICELLUS and PENNYWISE regulates Arabidopsis inflorescence architecture.
    Plant Physiol., 2012. 158(2): p. 946-60
    [PMID:22114095]
  71. Li Y,Pi L,Huang H,Xu L
    ATH1 and KNAT2 proteins act together in regulation of plant inflorescence architecture.
    J. Exp. Bot., 2012. 63(3): p. 1423-33
    [PMID:22140242]
  72. Butenko MA,Shi CL,Aalen RB
    KNAT1, KNAT2 and KNAT6 act downstream in the IDA-HAE/HSL2 signaling pathway to regulate floral organ abscission.
    Plant Signal Behav, 2012. 7(1): p. 135-8
    [PMID:22301980]
  73. Han HJ, et al.
    The transcriptional repressor activity of ASYMMETRIC LEAVES1 is inhibited by direct interaction with calmodulin in Arabidopsis.
    Plant Cell Environ., 2012. 35(11): p. 1969-82
    [PMID:22554014]
  74. Khan M,Tabb P,Hepworth SR
    BLADE-ON-PETIOLE1 and 2 regulate Arabidopsis inflorescence architecture in conjunction with homeobox genes KNAT6 and ATH1.
    Plant Signal Behav, 2012. 7(7): p. 788-92
    [PMID:22751300]
  75. Rast MI,Simon R
    Arabidopsis JAGGED LATERAL ORGANS acts with ASYMMETRIC LEAVES2 to coordinate KNOX and PIN expression in shoot and root meristems.
    Plant Cell, 2012. 24(7): p. 2917-33
    [PMID:22822207]
  76. Schiessl K,Kausika S,Southam P,Bush M,Sablowski R
    JAGGED controls growth anisotropyand coordination between cell sizeand cell cycle during plant organogenesis.
    Curr. Biol., 2012. 22(19): p. 1739-46
    [PMID:22902754]
  77. Gonz
    Antagonistic gene activities determine the formation of pattern elements along the mediolateral axis of the Arabidopsis fruit.
    PLoS Genet., 2012. 8(11): p. e1003020
    [PMID:23133401]
  78. Etchells JP, et al.
    A role for BELLRINGER in cell wall development is supported by loss-of-function phenotypes.
    BMC Plant Biol., 2012. 12: p. 212
    [PMID:23148846]
  79. Luo M, et al.
    Histone deacetylase HDA6 is functionally associated with AS1 in repression of KNOX genes in arabidopsis.
    PLoS Genet., 2012. 8(12): p. e1003114
    [PMID:23271976]
  80. Lodha M,Marco CF,Timmermans MC
    The ASYMMETRIC LEAVES complex maintains repression of KNOX homeobox genes via direct recruitment of Polycomb-repressive complex2.
    Genes Dev., 2013. 27(6): p. 596-601
    [PMID:23468429]
  81. Scofield S,Dewitte W,Nieuwland J,Murray JA
    The Arabidopsis homeobox gene SHOOT MERISTEMLESS has cellular and meristem-organisational roles with differential requirements for cytokinin and CYCD3 activity.
    Plant J., 2013. 75(1): p. 53-66
    [PMID:23573875]
  82. Stammler A, et al.
    Duplicated STM-like KNOX I genes act in floral meristem activity in Eschscholzia californica (Papaveraceae).
    Dev. Genes Evol., 2013. 223(5): p. 289-301
    [PMID:23636178]
  83. Qi B,Zheng H
    Modulation of root-skewing responses by KNAT1 in Arabidopsis thaliana.
    Plant J., 2013. 76(3): p. 380-92
    [PMID:23889705]
  84. Marsch-Mart
    The NTT transcription factor promotes replum development in Arabidopsis fruits.
    Plant J., 2014. 80(1): p. 69-81
    [PMID:25039392]
  85. We
    Convergent targeting of a common host protein-network by pathogen effectors from three kingdoms of life.
    Cell Host Microbe, 2014. 16(3): p. 364-75
    [PMID:25211078]
  86. Liebsch D, et al.
    Class I KNOX transcription factors promote differentiation of cambial derivatives into xylem fibers in the Arabidopsis hypocotyl.
    Development, 2014. 141(22): p. 4311-9
    [PMID:25371365]
  87. Furumizu C,Alvarez JP,Sakakibara K,Bowman JL
    Antagonistic roles for KNOX1 and KNOX2 genes in patterning the land plant body plan following an ancient gene duplication.
    PLoS Genet., 2015. 11(2): p. e1004980
    [PMID:25671434]
  88. Jin J, et al.
    An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors.
    Mol. Biol. Evol., 2015. 32(7): p. 1767-73
    [PMID:25750178]
  89. Zhao M, et al.
    Arabidopsis BREVIPEDICELLUS interacts with the SWI2/SNF2 chromatin remodeling ATPase BRAHMA to regulate KNAT2 and KNAT6 expression in control of inflorescence architecture.
    PLoS Genet., 2015. 11(3): p. e1005125
    [PMID:25822547]
  90. Ding L, et al.
    HANABA TARANU (HAN) Bridges Meristem and Organ Primordia Boundaries through PINHEAD, JAGGED, BLADE-ON-PETIOLE2 and CYTOKININ OXIDASE 3 during Flower Development in Arabidopsis.
    PLoS Genet., 2015. 11(9): p. e1005479
    [PMID:26390296]
  91. Lincoln C,Long J,Yamaguchi J,Serikawa K,Hake S
    A knotted1-like homeobox gene in Arabidopsis is expressed in the vegetative meristem and dramatically alters leaf morphology when overexpressed in transgenic plants.
    Plant Cell, 1994. 6(12): p. 1859-76
    [PMID:7866029]
  92. Hake S, et al.
    Homeobox genes in the functioning of plant meristems.
    Philos. Trans. R. Soc. Lond., B, Biol. Sci., 1995. 350(1331): p. 45-51
    [PMID:8577849]
  93. Granger CL,Callos JD,Medford JI
    Isolation of an Arabidopsis homologue of the maize homeobox Knotted-1 gene.
    Plant Mol. Biol., 1996. 31(2): p. 373-8
    [PMID:8756600]
  94. Chuck G,Lincoln C,Hake S
    KNAT1 induces lobed leaves with ectopic meristems when overexpressed in Arabidopsis.
    Plant Cell, 1996. 8(8): p. 1277-89
    [PMID:8776897]
  95. Serikawa KA,Martinez-Laborda A,Zambryski P
    Three knotted1-like homeobox genes in Arabidopsis.
    Plant Mol. Biol., 1996. 32(4): p. 673-83
    [PMID:8980519]
  96. Serikawa KA,Zambryski PC
    Domain exchanges between KNAT3 and KNAT1 suggest specificity of the kn1-like homeodomains requires sequences outside of the third helix and N-terminal arm of the homeodomain.
    Plant J., 1997. 11(4): p. 863-9
    [PMID:9161041]