PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT4G03250.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family HB-other
Protein Properties Length: 507aa    MW: 56823.8 Da    PI: 8.9698
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT4G03250.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox57.32.6e-182176257
                 T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
     Homeobox  2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57
                 +kR   t+ q+ +Le+++++++yp++e++ +LA+++gLte+qV+ WF+ rR k+k+
  AT4G03250.1 21 KKRKLKTPMQVMALENFYNEHKYPTEEMKGKLAEEVGLTEKQVSGWFCHRRLKDKR 76
                 899***************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.2E-20377IPR009057Homeodomain-like
SuperFamilySSF466896.84E-171679IPR009057Homeodomain-like
PROSITE profilePS5007116.5681777IPR001356Homeobox domain
SMARTSM003892.0E-181981IPR001356Homeobox domain
CDDcd000862.00E-162177No hitNo description
PfamPF000461.1E-152176IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000293anatomyguard cell
Sequence ? help Back to Top
Protein Sequence    Length: 507 aa     Download sequence    Send to blast
MHSDSGEATA DGDKASTENS KKRKLKTPMQ VMALENFYNE HKYPTEEMKG KLAEEVGLTE  60
KQVSGWFCHR RLKDKRHVKE DGNAIGSQDR SSVVLQDRGS GLRQDSCGST KQTDYWNPKP  120
REVESQRLYM GNADGEDSTS SDRSSSLRKN LVSSKDGIRD VESSRYVAHK DVIQHPQFMR  180
SYGYNKPSGY LKVKGESENF AITAVKRQLG RQYQEDGPPL GVEFDPLPPG AFEPQTNPIV  240
HEPIYVGNQR RPHLPHLLGT RKSFNPGPSY ELARKSKLHS PDPDSEDDEH DDDDNIMVGM  300
EPGLRDKKSF GEPRLKSPST SFYNSVPRHK SFKETFKGSP REIPVTNSKK GWISSKSWAE  360
GSRNHLVANV QNLSGSNIET NQSHDYDNNI SNGGRKTGYL TKSSKLLPPS RSRSPESMDR  420
GPSSGMAGIY HGERNQMKMQ REKLHSTDEP PVAKRVKHGY IQQVYAPKSS SYSEILERKS  480
QINRSGVELP SSLSGDDETD ESSSSMD
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO3341863400.0
Expression AtlasAT4G03250-
AtGenExpressAT4G03250-
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT4G03250.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Interaction ? help Back to Top
Source Intact With
BioGRIDAT1G14920
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT4G03250
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0263720.0BT026372.1 Arabidopsis thaliana At4g03250 mRNA, complete cds.
GenBankAJ4412960.0AJ441296.1 Arabidopsis thaliana mRNA for homeodomain protein 14 (hd-14 gene).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_192234.20.0homeodomain-like superfamily protein
TrEMBLF4JI720.0F4JI72_ARATH; Homeodomain-like superfamily protein
STRINGAT4G03250.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP8823814
MalvidsOGEM122022531
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Causier B,Ashworth M,Guo W,Davies B
    The TOPLESS interactome: a framework for gene repression in Arabidopsis.
    Plant Physiol., 2012. 158(1): p. 423-38
    [PMID:22065421]
  3. Mar
    Large-scale identification of gibberellin-related transcription factors defines group VII ETHYLENE RESPONSE FACTORS as functional DELLA partners.
    Plant Physiol., 2014. 166(2): p. 1022-32
    [PMID:25118255]