PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT4G02235.1
Common NameAGL51, T2H3.15
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family M-type_MADS
Protein Properties Length: 196aa    MW: 22478.4 Da    PI: 10.1859
Description AGAMOUS-like 51
Gene Model
Gene Model ID Type Source Coding Sequence
AT4G02235.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF82.92.1e-26756251
                 ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
       SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                 +++++s++++++++R+++i+KKAeELS+LC+++v+vi+++++g+l+++++
  AT4G02235.1  7 SSSSSSRNSTSLTNRLKTIFKKAEELSILCAIDVCVIYYGPDGELRTWPK 56
                 6899********************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004322.8E-4557IPR002100Transcription factor, MADS-box
PROSITE profilePS5006610.4421058IPR002100Transcription factor, MADS-box
PfamPF003191.6E-141054IPR002100Transcription factor, MADS-box
SuperFamilySSF554553.27E-151280IPR002100Transcription factor, MADS-box
CDDcd002664.58E-152179No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 196 aa     Download sequence    Send to blast
MKQSSFSSSS SSRNSTSLTN RLKTIFKKAE ELSILCAIDV CVIYYGPDGE LRTWPKERNT  60
VKDMASRYKE ATKRKKKRTL STLQERLRIV ESQKQQNKNL VHQSLTPSYL NQIQHLNPSN  120
FSPYMYNHGD AATLSQLPLS ASLSNQLQLP ESLDAAWFWS EHVFGQHHQQ QQLSTSWRVK  180
HTRILTVSFG TSICSE
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasAT4G02235
AtGenExpressAT4G02235
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that may function in the maintenance of the proper function of the central cell in pollen tube attraction. {ECO:0000305|PubMed:26462908}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT4G02235.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT4G02235
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY1412150.0AY141215.1 Arabidopsis thaliana MADS-box protein AGL51 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_974500.11e-145AGAMOUS-like 51
SwissprotQ9FLL02e-39AGL75_ARATH; Agamous-like MADS-box protein AGL75
TrEMBLA0A178UXV61e-143A0A178UXV6_ARATH; AGL51
TrEMBLO814211e-143O81421_ARATH; AGAMOUS-like 51
STRINGAT4G02235.11e-144(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM56620126
Representative plantOGRP6766218
Publications ? help Back to Top
  1. Parenicov√° L, et al.
    Molecular and phylogenetic analyses of the complete MADS-box transcription factor family in Arabidopsis: new openings to the MADS world.
    Plant Cell, 2003. 15(7): p. 1538-51
    [PMID:12837945]
  2. de Folter S, et al.
    Comprehensive interaction map of the Arabidopsis MADS Box transcription factors.
    Plant Cell, 2005. 17(5): p. 1424-33
    [PMID:15805477]
  3. Zhang S, et al.
    FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development.
    Plant Physiol., 2018. 177(1): p. 285-299
    [PMID:29523711]