PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT4G01680.2
Common NameAtMYB55, MYB55, T15B16.4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB
Protein Properties Length: 348aa    MW: 39317 Da    PI: 7.6026
Description myb domain protein 55
Gene Model
Gene Model ID Type Source Coding Sequence
AT4G01680.2genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.59.5e-161473148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT............TTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmg............kgRtlkqcksrwqkyl 48
                     +g W++eEde+l+++++++G g+W+++++  g            + R++k+c++rw +yl
      AT4G01680.2 14 KGLWSPEEDEKLLRYITKYGHGCWSSVPKQAGtflfiqihllfgLQRCGKSCRLRWINYL 73
                     678*******************************************************97 PP

2Myb_DNA-binding45.61.6e-1479122146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+++++E+ l++++++ lG++ W+ Ia+ ++ gRt++++k+ w++
      AT4G01680.2  79 RGAFSQDEENLIIELHAVLGNR-WSQIAAQLP-GRTDNEIKNLWNS 122
                      89********************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.0E-27676IPR009057Homeodomain-like
PROSITE profilePS5129415.451973IPR017930Myb domain
SuperFamilySSF466896.97E-2812120IPR009057Homeodomain-like
SMARTSM007173.6E-111375IPR001005SANT/Myb domain
PfamPF002493.2E-141473IPR001005SANT/Myb domain
CDDcd001677.20E-111773No hitNo description
PROSITE profilePS5129425.50774128IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.8E-2577128IPR009057Homeodomain-like
SMARTSM007179.1E-1378126IPR001005SANT/Myb domain
PfamPF002492.0E-1379123IPR001005SANT/Myb domain
CDDcd001674.08E-981121No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0030154Biological Processcell differentiation
GO:0005634Cellular Componentnucleus
GO:0000981Molecular FunctionRNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001135Molecular Functiontranscription factor activity, RNA polymerase II transcription factor recruiting
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 348 aa     Download sequence    Send to blast
MGRHSCCYKQ KLRKGLWSPE EDEKLLRYIT KYGHGCWSSV PKQAGTFLFI QIHLLFGLQR  60
CGKSCRLRWI NYLRPDLKRG AFSQDEENLI IELHAVLGNR WSQIAAQLPG RTDNEIKNLW  120
NSCLKKKLRL RGIDPVTHKL LTEIETGTDD KTKPVEKSQQ TYLVETDGSS STTTCSTNQN  180
NNTDHLYTGN FGFQRLSLEN GSRIAAGSDL GIWIPQTGRN HHHHVDETIP SAVVLPGSMF  240
SSGLTGYRSS NLGLIELENS FSTGPMMTEH QQIQESNYNN STFFGNGNLN WGLTMEENQN  300
PFTISNHSNS SLYSDIKSET NFFGTEATNV GMWPCNQLQP QQHAYGHI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-27121285108B-MYB
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1453398990.0
Genevisible255538_at0.0
Expression AtlasAT4G01680-
AtGenExpressAT4G01680-
ATTED-IIAT4G01680-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed specifically in guard cells (PubMed:16005292). Expressed in sink tissues, such as xylem, roots and developing seeds (PubMed:22708996). {ECO:0000269|PubMed:16005292, ECO:0000269|PubMed:22708996}.
Functional Description ? help Back to Top
Source Description
TAIREncodes a putative transcription factor (MYB55).
UniProtTranscription factor that coordinates a small network of downstream target genes required for several aspects of plant growth and development, such as xylem formation and xylem cell differentiation, and lateral root formation (PubMed:22708996). Regulates a specific set of target genes by binding DNA to the AC cis-element 5'-ACCTAC-3' (PubMed:23741471). Functions as a transcriptional regulator of stomatal closure. Plays a role the regulation of stomatal pore size independently of abscisic acid (ABA) (PubMed:16005292). Required for seed coat mucilage deposition during the development of the seed coat epidermis (PubMed:19401413). Involved in the induction of trichome initiation and branching by positively regulating GL1 and GL2. Required for gibberellin (GA) biosynthesis and degradation by positively affecting the expression of the enzymes that convert GA9 into the bioactive GA4, as well as the enzymes involved in the degradation of GA4 (PubMed:28207974). {ECO:0000269|PubMed:16005292, ECO:0000269|PubMed:19401413, ECO:0000269|PubMed:22708996, ECO:0000269|PubMed:23741471, ECO:0000269|PubMed:28207974}.
Function -- GeneRIF ? help Back to Top
  1. MYB55 was higher expressed in basal cells than in trichome and pavement cells.
    [PMID: 20101514]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00427DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT4G01680.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT4G01680
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF1760000.0AF176000.2 Arabidopsis thaliana putative transcription factor (MYB55) mRNA, complete cds.
GenBankAY0545750.0AY054575.1 Arabidopsis thaliana Unknown protein (At4g01680; T15B16.4) mRNA, complete cds.
GenBankBT0003520.0BT000352.1 Arabidopsis thaliana Unknown protein (At4g01680) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001031571.10.0myb domain protein 55
SwissprotQ8VZQ21e-81MYB61_ARATH; Transcription factor MYB61
TrEMBLQ9ZSI40.0Q9ZSI4_ARATH; Myb domain protein 55
STRINGAT4G01680.20.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Representative plantOGRP5171784
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Stracke R,Werber M,Weisshaar B
    The R2R3-MYB gene family in Arabidopsis thaliana.
    Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56
    [PMID:11597504]
  3. Goda H, et al.
    Comprehensive comparison of auxin-regulated and brassinosteroid-regulated genes in Arabidopsis.
    Plant Physiol., 2004. 134(4): p. 1555-73
    [PMID:15047898]
  4. He JX, et al.
    BZR1 is a transcriptional repressor with dual roles in brassinosteroid homeostasis and growth responses.
    Science, 2005. 307(5715): p. 1634-8
    [PMID:15681342]
  5. Nakamura A, et al.
    Arabidopsis Aux/IAA genes are involved in brassinosteroid-mediated growth responses in a manner dependent on organ type.
    Plant J., 2006. 45(2): p. 193-205
    [PMID:16367964]
  6. Ditt RF, et al.
    The Arabidopsis thaliana transcriptome in response to Agrobacterium tumefaciens.
    Mol. Plant Microbe Interact., 2006. 19(6): p. 665-81
    [PMID:16776300]
  7. Zhao J, et al.
    Analysis of gene expression profiles in response to Sclerotinia sclerotiorum in Brassica napus.
    Planta, 2007. 227(1): p. 13-24
    [PMID:17665211]
  8. Schliep M,Ebert B,Simon-Rosin U,Zoeller D,Fisahn J
    Quantitative expression analysis of selected transcription factors in pavement, basal and trichome cells of mature leaves from Arabidopsis thaliana.
    Protoplasma, 2010. 241(1-4): p. 29-36
    [PMID:20101514]
  9. Gaudinier A, et al.
    Enhanced Y1H assays for Arabidopsis.
    Nat. Methods, 2011. 8(12): p. 1053-5
    [PMID:22037706]
  10. Heyndrickx KS,Vandepoele K
    Systematic identification of functional plant modules through the integration of complementary data sources.
    Plant Physiol., 2012. 159(3): p. 884-901
    [PMID:22589469]
  11. Matías-Hernández L, et al.
    AaMYB1 and its orthologue AtMYB61 affect terpene metabolism and trichome development in Artemisia annua and Arabidopsis thaliana.
    Plant J., 2017. 90(3): p. 520-534
    [PMID:28207974]