PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT4G01550.1
Common NameANAC069, F11O4.5, NAC069, NAC69, NTL13, NTM2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family NAC
Protein Properties Length: 457aa    MW: 51816 Da    PI: 5.26
Description NAC domain containing protein 69
Gene Model
Gene Model ID Type Source Coding Sequence
AT4G01550.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM136.41.8e-4261353128
          NAM   3 pGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp..kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk..k 96 
                  +G+rF Pt eel+++yLk+k+ gk+  ++e+i+e++i++++P  Lp  +k+k+++  wyfF++++ ++a++k ++r+t+sgyWkatg d+++++k  +
  AT4G01550.1   6 VGYRFYPTGEELINHYLKNKILGKTWLVDEAISEINICSYDPIYLPslSKIKSDDPVWYFFCPKEYTSAKKKVTKRTTSSGYWKATGVDRKIKDKrgN 103
                  7************************999999***************5449999999**************************************9666 PP

          NAM  97 gelvglkktLvfykgrapkgektdWvmheyrl 128
                  + ++g+kktLv+y+gr pkg+ t Wvmhey++
  AT4G01550.1 104 RGEIGIKKTLVYYEGRVPKGVWTPWVMHEYHI 135
                  667***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100545.5774153IPR003441NAC domain
SuperFamilySSF1019411.83E-465153IPR003441NAC domain
PfamPF023657.5E-256135IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007275Biological Processmulticellular organism development
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005886Cellular Componentplasma membrane
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000084anatomyplant sperm cell
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 457 aa     Download sequence    Send to blast
MVKDLVGYRF YPTGEELINH YLKNKILGKT WLVDEAISEI NICSYDPIYL PSLSKIKSDD  60
PVWYFFCPKE YTSAKKKVTK RTTSSGYWKA TGVDRKIKDK RGNRGEIGIK KTLVYYEGRV  120
PKGVWTPWVM HEYHITCLPQ DQRNYVICQV MYKGEDGDVP SGGNNSSEPS QSLVSDSNTV  180
RATSPTALEF EKPGQENFFG MSVDDLGTPK NEQEDFSLWD VLDPDMLFSD NNNPTVHPQA  240
PHLTPNDDEF LGGLRHVNRE QVEYLFANED FISRPTLSMT ENRNDHRPKK ALSGIIVDYS  300
SDSNSDAESI SATSYQGTSS PGDDSVGSSN RQFLQTGGDE ILSSCNDLQT YGEPSISSST  360
RQSQLTRSII RPKQEVKQDT SRAVDSDTSI DKESSMVKTE KKSWFITEEA MERNRNNPRY  420
IYLMRMIIGF ILLLALISNI ISVLQNLNPA MKFDRER
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A6e-25715320165NO APICAL MERISTEM PROTEIN
1ut4_B6e-25715320165NO APICAL MERISTEM PROTEIN
1ut7_A6e-25715320165NO APICAL MERISTEM PROTEIN
1ut7_B6e-25715320165NO APICAL MERISTEM PROTEIN
4dul_A6e-25715320165NAC domain-containing protein 19
4dul_B6e-25715320165NAC domain-containing protein 19
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.344080.0flower| seed
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible255585_at0.0
Expression AtlasAT4G01550-
AtGenExpressAT4G01550-
ATTED-IIAT4G01550-
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator activated by proteolytic cleavage through regulated intramembrane proteolysis (RIP). Involved in salt stress response during seed germination and seedling growth. Binds the auxin-responsive IAA30 gene promoter and may serve as a molecular link that interconnects a developmental feedback loop of auxin signaling with a salt signal transduction pathway during seed germination (PubMed:21450938). {ECO:0000269|PubMed:21450938}.
Function -- GeneRIF ? help Back to Top
  1. Auxin delays seed germination under high salinity through cross talk with the NTM2-mediated salt signaling in Arabidopsis.
    [PMID: 21450938]
  2. NTM2 is a molecular link that incorporates auxin signal into salt stress signaling during seed germination.
    [PMID: 21757997]
  3. ATDOF5.8 regulates the expression of ANAC069
    [PMID: 25572919]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00426DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT4G01550.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By salt stress and abscisic acid (ABA) in roots. {ECO:0000269|PubMed:21450938}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Disruption Phenotype ? help Back to Top
Source Description
UniProtDISRUPTION PHENOTYPE: No visible phenotype under normal growth conditions, but mutant plants mutant exhibit reduced sensitivity to high salinity during seed germination and seedling development. {ECO:0000269|PubMed:21450938}.
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT4G01550
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2293120.0AK229312.1 Arabidopsis thaliana mRNA for putative NAM-like protein, complete cds, clone: RAFL16-57-J19.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_192064.10.0NAC transcription factor
SwissprotQ9M1260.0NAC69_ARATH; NAC domain-containing protein 69
TrEMBLR0GRZ70.0R0GRZ7_9BRAS; Uncharacterized protein
STRINGAT4G01550.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM19821971
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Ooka H, et al.
    Comprehensive analysis of NAC family genes in Oryza sativa and Arabidopsis thaliana.
    DNA Res., 2003. 10(6): p. 239-47
    [PMID:15029955]
  3. Guan Y,Nothnagel EA
    Binding of arabinogalactan proteins by Yariv phenylglycoside triggers wound-like responses in Arabidopsis cell cultures.
    Plant Physiol., 2004. 135(3): p. 1346-66
    [PMID:15235117]
  4. Knowles DG,McLysaght A
    High rate of recent intron gain and loss in simultaneously duplicated Arabidopsis genes.
    Mol. Biol. Evol., 2006. 23(8): p. 1548-57
    [PMID:16720694]
  5. Jiang Y,Deyholos MK
    Comprehensive transcriptional profiling of NaCl-stressed Arabidopsis roots reveals novel classes of responsive genes.
    BMC Plant Biol., 2006. 6: p. 25
    [PMID:17038189]
  6. Kim YS, et al.
    A membrane-bound NAC transcription factor regulates cell division in Arabidopsis.
    Plant Cell, 2006. 18(11): p. 3132-44
    [PMID:17098812]
  7. Kim SY, et al.
    Exploring membrane-associated NAC transcription factors in Arabidopsis: implications for membrane biology in genome regulation.
    Nucleic Acids Res., 2007. 35(1): p. 203-13
    [PMID:17158162]
  8. Fleury D, et al.
    The Arabidopsis thaliana homolog of yeast BRE1 has a function in cell cycle regulation during early leaf and root growth.
    Plant Cell, 2007. 19(2): p. 417-32
    [PMID:17329565]
  9. Park J, et al.
    Integration of auxin and salt signals by the NAC transcription factor NTM2 during seed germination in Arabidopsis.
    Plant Physiol., 2011. 156(2): p. 537-49
    [PMID:21450938]
  10. Jung JH,Park CM
    Auxin modulation of salt stress signaling in Arabidopsis seed germination.
    Plant Signal Behav, 2011. 6(8): p. 1198-200
    [PMID:21757997]
  11. Klopffleisch K, et al.
    Arabidopsis G-protein interactome reveals connections to cell wall carbohydrates and morphogenesis.
    Mol. Syst. Biol., 2011. 7: p. 532
    [PMID:21952135]
  12. He L,Su C,Wang Y,Wei Z
    ATDOF5.8 protein is the upstream regulator of ANAC069 and is responsive to abiotic stress.
    Biochimie, 2015. 110: p. 17-24
    [PMID:25572919]