PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT4G01540.2
Common NameANAC068, NTM1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family NAC
Protein Properties Length: 423aa    MW: 48236.8 Da    PI: 6.2436
Description NAC with transmembrane motif1
Gene Model
Gene Model ID Type Source Coding Sequence
AT4G01540.2genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM126.32.4e-3961363128
          NAM   3 pGfrFhPtdeelvveyLkkkvegkkleleevikevdiykveP.wdLpk..kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.. 95 
                   G+rF+Pt ee++++yLk+k+ gk   ++e+i+e++i++++P +dLpk  ++++e+ ewyfFs+ + +++++ + +r+t sg+Wk tg d+e+ +k  
  AT4G01540.2   6 IGYRFSPTGEEVINHYLKNKLLGKYWLVDEAISEINILSHKPsKDLPKlaRIQSEDLEWYFFSPIEYTNPNKMKMKRTTGSGFWKPTGVDREIRDKrg 103
                  69***********************999999***********558995458888888**************************************977 PP

          NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrl 128
                  +g ++g+kktLv+++g++p+g++t Wvmhey++
  AT4G01540.2 104 NGVVIGIKKTLVYHEGKSPHGVRTPWVMHEYHI 136
                  7888***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.01E-444154IPR003441NAC domain
PROSITE profilePS5100545.0194154IPR003441NAC domain
PfamPF023656.9E-227136IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009736Biological Processcytokinin-activated signaling pathway
GO:0009965Biological Processleaf morphogenesis
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0051302Biological Processregulation of cell division
GO:0005789Cellular Componentendoplasmic reticulum membrane
GO:0016021Cellular Componentintegral component of membrane
GO:0031965Cellular Componentnuclear membrane
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000293anatomyguard cell
Sequence ? help Back to Top
Protein Sequence    Length: 423 aa     Download sequence    Send to blast
MMKGLIGYRF SPTGEEVINH YLKNKLLGKY WLVDEAISEI NILSHKPSKD LPKLARIQSE  60
DLEWYFFSPI EYTNPNKMKM KRTTGSGFWK PTGVDREIRD KRGNGVVIGI KKTLVYHEGK  120
SPHGVRTPWV MHEYHITCLP HHKRKYVVCQ VKYKGEAAEI SYEPSPSLVS DSHTVIAITG  180
EPEPELQVEQ PGKENLLGMS VDDLIEPMNQ QEEPQGPHLA PNDDEFIRGL RHVDRGTVEY  240
LFANEENMDG LSMNDLRIPM IVQQEDLSEW EGFNADTFFS DNNNNYNLNV HHQLTPYGDG  300
YLNAFSGYNE GNPPDHELVM QENRNDHMPR KPVTGTIDYS SDSGSDAGSI STTVKQEIPR  360
AVDAPMNNES SLVKTEKKGL FIVEDAMERN RKKPRFIYLM KMIIGNIISV LLPVKRLIPV  420
KKL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A1e-25713618140Stress-induced transcription factor NAC1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1388394RNRKKPR
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1453398910.0
Expression AtlasAT4G01540-
AtGenExpressAT4G01540-
Functional Description ? help Back to Top
Source Description
TAIREncodes a membrane-bound NAC (for NAM, ATAF1/2, CUC2) transcription factor, designated NTM1 (for NAC with transmembrane motif1). NTM1 regulates cell division in Arabidopsis.
Function -- GeneRIF ? help Back to Top
  1. Membrane-bound transcription factor, NTM1 (for NAC with transmembrane motif1), that belongs to the plant-specific NAC transcription factor family controls cell division in Arabidopsis.
    [PMID: 17098812]
  2. Data suggest that the reduced growth observed in the ntm1-D mutant is caused by enhancement of its stress responses, possibly resulting in a cost in fitness.
    [PMID: 18319616]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00425DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT4G01540.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top
Source Target Gene (A: Activate/R: Repress)
ATRM AT1G49620(A), AT4G34160(A)
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT4G01540
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB4936710.0AB493671.1 Arabidopsis thaliana At4g01540 mRNA for hypothetical protein, partial cds, clone: RAAt4g01540.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001078343.10.0NAC with transmembrane motif1
SwissprotA8MQY10.0NAC68_ARATH; NAC domain-containing protein 68
TrEMBLF4JI380.0F4JI38_ARATH; NAC domain-containing protein 68
STRINGAT4G01540.10.0(Arabidopsis thaliana)
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Ooka H, et al.
    Comprehensive analysis of NAC family genes in Oryza sativa and Arabidopsis thaliana.
    DNA Res., 2003. 10(6): p. 239-47
    [PMID:15029955]
  3. Scheible WR, et al.
    Genome-wide reprogramming of primary and secondary metabolism, protein synthesis, cellular growth processes, and the regulatory infrastructure of Arabidopsis in response to nitrogen.
    Plant Physiol., 2004. 136(1): p. 2483-99
    [PMID:15375205]
  4. Kim YS, et al.
    A membrane-bound NAC transcription factor regulates cell division in Arabidopsis.
    Plant Cell, 2006. 18(11): p. 3132-44
    [PMID:17098812]
  5. Lee KH,Kim YS,Park CM,Kim HJ
    Proteomic identification of differentially expressed proteins in Arabidopsis mutant ntm1-D with disturbed cell division.
    Mol. Cells, 2008. 25(1): p. 70-7
    [PMID:18319616]
  6. Kim YS,Park CM
    Membrane regulation of cytokinin-mediated cell division in Arabidopsis.
    Plant Signal Behav, 2007. 2(1): p. 15-6
    [PMID:19704799]
  7. Jin J, et al.
    An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors.
    Mol. Biol. Evol., 2015. 32(7): p. 1767-73
    [PMID:25750178]