PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT4G01280.1
Common NameF2N1.20, RVE5
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB_related
Protein Properties Length: 302aa    MW: 33791.3 Da    PI: 9.732
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT4G01280.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding445.3e-1459103147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      r +WT +E++++++a +++  + Wk+I + +g  +t  q++s+ qky
      AT4G01280.1  59 RENWTDQEHDKFLEALHLFDRD-WKKIEAFVG-SKTVVQIRSHAQKY 103
                      789*****************77.*********.*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466898.22E-1753109IPR009057Homeodomain-like
PROSITE profilePS5129415.20654108IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.1E-756109IPR009057Homeodomain-like
TIGRFAMsTIGR015571.5E-1757106IPR006447Myb domain, plants
SMARTSM007173.3E-1158106IPR001005SANT/Myb domain
PfamPF002496.6E-1259103IPR001005SANT/Myb domain
CDDcd001678.95E-961104No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000084anatomyplant sperm cell
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 302 aa     Download sequence    Send to blast
MVSVNPRPKG FPVFDSSNMS LPSSDGFGSI PATGRTSTVS FSEDPTTKIR KPYTIKKSRE  60
NWTDQEHDKF LEALHLFDRD WKKIEAFVGS KTVVQIRSHA QKYFLKVQKS GANEHLPPPR  120
PKRKASHPYP IKAPKNVAYT SLPSSSTLPL LEPGYLYSSD SKSLMGNQAV CASTSSSWNH  180
ESTNLPKPVI EEEPGVSATA PLPNNRCRQE DTERVRAVTK PNNEESCEKP HRVMPNFAEV  240
YSFIGSVFDP NTSGHLQRLK QMDPINMETV LLLMQNLSVN LTSPEFAEQR RLISSYSAKA  300
LK
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.442340.0flower| silique
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1865114170.0
Genevisible255614_at0.0
Expression AtlasAT4G01280-
AtGenExpressAT4G01280-
ATTED-IIAT4G01280-
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Function -- GeneRIF ? help Back to Top
  1. REVEILLE clock genes rve3 4 5 6 8 mutants are much larger than wild-type plants, with both increased leaf area and biomass.
    [PMID: 28254761]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00423DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT4G01280.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- Hormone ? help Back to Top
Source Hormone
AHDabscisic acid, auxin, ethylene, gibberellin, jasmonic acid, salicylic acid
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT4G01280
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ9372120.0AJ937212.1 Arabidopsis thaliana mRNA for myb transcription factor LHY-CCA1-like4 (lcl4 gene).
GenBankBT0247110.0BT024711.1 Arabidopsis thaliana At4g01280 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_192037.20.0Homeodomain-like superfamily protein
SwissprotC0SVG50.0RVE5_ARATH; Protein REVEILLE 5
TrEMBLA0A178UWH70.0A0A178UWH7_ARATH; Uncharacterized protein
STRINGAT4G01280.20.0(Arabidopsis thaliana)
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Dal Bosco C, et al.
    Inactivation of the chloroplast ATP synthase gamma subunit results in high non-photochemical fluorescence quenching and altered nuclear gene expression in Arabidopsis thaliana.
    J. Biol. Chem., 2004. 279(2): p. 1060-9
    [PMID:14576160]
  3. Yanhui C, et al.
    The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family.
    Plant Mol. Biol., 2006. 60(1): p. 107-24
    [PMID:16463103]
  4. Rawat R, et al.
    REVEILLE1, a Myb-like transcription factor, integrates the circadian clock and auxin pathways.
    Proc. Natl. Acad. Sci. U.S.A., 2009. 106(39): p. 16883-8
    [PMID:19805390]
  5. Gray JA,Shalit-Kaneh A,Chu DN,Hsu PY,Harmer SL
    The REVEILLE Clock Genes Inhibit Growth of Juvenile and Adult Plants by Control of Cell Size.
    Plant Physiol., 2017. 173(4): p. 2308-2322
    [PMID:28254761]