PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT4G00940.1
Common NameAtDOF4.1, A_TM018A10.2, DOF4.1, ITD1, T18A10.24
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family Dof
Protein Properties Length: 294aa    MW: 33389.6 Da    PI: 7.4783
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT4G00940.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof119.21.5e-3764122260
       zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60 
                  +++ ++cprC+s+ntkfCyynnysl+qPry+Ck+CrryWt+GG+lrnvPvGgg+rknkk
  AT4G00940.1  64 PQEPRNCPRCNSSNTKFCYYNNYSLAQPRYLCKSCRRYWTEGGSLRNVPVGGGSRKNKK 122
                  67899****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-2963122IPR003851Zinc finger, Dof-type
PfamPF027018.2E-3366122IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.44468122IPR003851Zinc finger, Dof-type
PROSITE patternPS01361070106IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046872Molecular Functionmetal ion binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0003015anatomyprimary root differentiation zone
PO:0005059anatomyroot endodermis
PO:0006203anatomypericycle
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009025anatomyvascular leaf
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025257anatomyprimary root elongation zone
PO:0001054developmental stagevascular leaf senescent stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 294 aa     Download sequence    Send to blast
MDHHQYHHHD QYQHQMMTST NNNSYNTIVT TQPPPTTTTM DSTTATTMIM DDEKKLMTTM  60
STRPQEPRNC PRCNSSNTKF CYYNNYSLAQ PRYLCKSCRR YWTEGGSLRN VPVGGGSRKN  120
KKLPFPNSST SSSTKNLPDL NPPFVFTSSA SSSNPSKTHQ NNNDLSLSFS SPMQDKRAQG  180
HYGHFSEQVV TGGQNCLFQA PMGMIQFRQE YDHEHPKKNL GFSLDRNEEE IGNHDNFVVN  240
EEGSKMMYPY GDHEDRQQHH HVRHDDGNKK REGGSSNELW SGIILGGDSG GPTW
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1453398720.0
Genevisible255651_at0.0
Expression AtlasAT4G00940-
AtGenExpressAT4G00940-
ATTED-IIAT4G00940-
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT4G00940.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT4G00940
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAL1614910.0AL161491.2 Arabidopsis thaliana DNA chromosome 4, contig fragment No. 3.
GenBankCP0026870.0CP002687.1 Arabidopsis thaliana chromosome 4 sequence.
GenBankTM018A100.0AF013294.1 Arabidopsis thaliana BAC TM018A10.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001329595.10.0Dof-type zinc finger DNA-binding family protein
RefseqNP_001329596.10.0Dof-type zinc finger DNA-binding family protein
RefseqNP_192003.20.0Dof-type zinc finger DNA-binding family protein
SwissprotQ9M1610.0DOF41_ARATH; Dof zinc finger protein DOF4.1
TrEMBLA0A178UY010.0A0A178UY01_ARATH; ITD1
STRINGAT4G00940.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM146951720
Representative plantOGRP3817445
Publications ? help Back to Top
  1. Yanagisawa S
    The Dof family of plant transcription factors.
    Trends Plant Sci., 2002. 7(12): p. 555-60
    [PMID:12475498]
  2. Lijavetzky D,Carbonero P,Vicente-Carbajosa J
    Genome-wide comparative phylogenetic analysis of the rice and Arabidopsis Dof gene families.
    BMC Evol. Biol., 2003. 3: p. 17
    [PMID:12877745]
  3. Vergnolle C, et al.
    The cold-induced early activation of phospholipase C and D pathways determines the response of two distinct clusters of genes in Arabidopsis cell suspensions.
    Plant Physiol., 2005. 139(3): p. 1217-33
    [PMID:16258011]
  4. Lee JY, et al.
    Transcriptional and posttranscriptional regulation of transcription factor expression in Arabidopsis roots.
    Proc. Natl. Acad. Sci. U.S.A., 2006. 103(15): p. 6055-60
    [PMID:16581911]
  5. Mace DL, et al.
    Quantification of transcription factor expression from Arabidopsis images.
    Bioinformatics, 2006. 22(14): p. e323-31
    [PMID:16873489]
  6. Chen H,Ahmad M,Rim Y,Lucas WJ,Kim JY
    Evolutionary and molecular analysis of Dof transcription factors identified a conserved motif for intercellular protein trafficking.
    New Phytol., 2013. 198(4): p. 1250-60
    [PMID:23506539]