PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT4G00730.1
Common NameAHDP, ANL2, F6N23.10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family HD-ZIP
Protein Properties Length: 802aa    MW: 87194.2 Da    PI: 6.1585
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT4G00730.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox65.66.8e-21135190156
                  TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
     Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                  +++ +++t++q++eLe++F+++++p++++r eL+k+l L++rqVk+WFqNrR+++k
  AT4G00730.1 135 KKRYHRHTPQQIQELESMFKECPHPDEKQRLELSKRLCLETRQVKFWFQNRRTQMK 190
                  688999***********************************************999 PP

2START216.77.9e-683245431206
                  HHHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS...SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEEEEEECTT CS
        START   1 elaeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv..dsgealrasgvvdmvlallveellddkeqWdetla....kaetlevissg 88 
                  ela++a++elvk+a++eep+Wvks     +++n+de++++f+++k     +ea+r+sg+v+ ++  lve+l+d++ +W+e+++    +a+t++vis g
  AT4G00730.1 324 ELALTAMDELVKLAQSEEPLWVKSLdgerDELNQDEYMRTFSSTKPtgLATEASRTSGMVIINSLALVETLMDSN-RWTEMFPcnvaRATTTDVISGG 420
                  5899*************************************9999999***************************.********************** PP

                  ......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEEEE-EE--SSXXHH CS
        START  89 ......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwvehvdlkgrlphw 179
                        galqlm+aelq+lsplvp R++ f+R+++q+ +g+w++vdvS+d+ ++++  ++v+R  +lpSg++++++sng+skvtwveh++++++++h+
  AT4G00730.1 421 magtinGALQLMNAELQVLSPLVPvRNVNFLRFCKQHAEGVWAVVDVSIDPVRENSGGAPVIR--RLPSGCVVQDVSNGYSKVTWVEHAEYDENQIHQ 516
                  ********************************************************9******..********************************* PP

                  HHHHHHHHHHHHHHHHHHHHTXXXXXX CS
        START 180 llrslvksglaegaktwvatlqrqcek 206
                  l+r+l++sgl +g ++w+atlqrqce+
  AT4G00730.1 517 LYRPLLRSGLGFGSQRWLATLQRQCEC 543
                  *************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.71E-20122192IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.9E-22123192IPR009057Homeodomain-like
PROSITE profilePS5007117.297132192IPR001356Homeobox domain
SMARTSM003899.5E-18133196IPR001356Homeobox domain
CDDcd000862.08E-18134192No hitNo description
PfamPF000462.0E-18135190IPR001356Homeobox domain
PROSITE patternPS000270167190IPR017970Homeobox, conserved site
PROSITE profilePS5084842.687315546IPR002913START domain
CDDcd088758.32E-113319542No hitNo description
SuperFamilySSF559613.69E-30319543No hitNo description
PfamPF018521.6E-61324543IPR002913START domain
SMARTSM002345.2E-42324543IPR002913START domain
SuperFamilySSF559613.38E-20562786No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009827Biological Processplant-type cell wall modification
GO:0042335Biological Processcuticle development
GO:0043481Biological Processanthocyanin accumulation in tissues in response to UV light
GO:0048765Biological Processroot hair cell differentiation
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0006036anatomyroot epidermis
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020131anatomylateral root cap
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 802 aa     Download sequence    Send to blast
MNFGSLFDNT PGGGSTGARL LSGLSYGNHT AATNVLPGGA MAQAAAAASL FSPPLTKSVY  60
ASSGLSLALE QPERGTNRGE ASMRNNNNVG GGGDTFDGSV NRRSREEEHE SRSGSDNVEG  120
ISGEDQDAAD KPPRKKRYHR HTPQQIQELE SMFKECPHPD EKQRLELSKR LCLETRQVKF  180
WFQNRRTQMK TQLERHENAL LRQENDKLRA ENMSIREAMR NPICTNCGGP AMLGDVSLEE  240
HHLRIENARL KDELDRVCNL TGKFLGHHHN HHYNSSLELA VGTNNNGGHF AFPPDFGGGG  300
GCLPPQQQQS TVINGIDQKS VLLELALTAM DELVKLAQSE EPLWVKSLDG ERDELNQDEY  360
MRTFSSTKPT GLATEASRTS GMVIINSLAL VETLMDSNRW TEMFPCNVAR ATTTDVISGG  420
MAGTINGALQ LMNAELQVLS PLVPVRNVNF LRFCKQHAEG VWAVVDVSID PVRENSGGAP  480
VIRRLPSGCV VQDVSNGYSK VTWVEHAEYD ENQIHQLYRP LLRSGLGFGS QRWLATLQRQ  540
CECLAILISS SVTSHDNTSI TPGGRKSMLK LAQRMTFNFC SGISAPSVHN WSKLTVGNVD  600
PDVRVMTRKS VDDPGEPPGI VLSAATSVWL PAAPQRLYDF LRNERMRCEW DILSNGGPMQ  660
EMAHITKGQD QGVSLLRSNA MNANQSSMLI LQETCIDASG ALVVYAPVDI PAMHVVMNGG  720
DSSYVALLPS GFAVLPDGGI DGGGSGDGDQ RPVGGGSLLT VAFQILVNNL PTAKLTVESV  780
ETVNNLISCT VQKIRAALQC ES
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.244420.0flower| root| seed| vegetative tissue
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible255636_at0.0
Expression AtlasAT4G00730-
AtGenExpressAT4G00730-
ATTED-IIAT4G00730-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in roots, stems, leaves and floral buds. {ECO:0000269|PubMed:10402424}.
Functional Description ? help Back to Top
Source Description
TAIREncodes a homeodomain protein of the HD-GLABRA2 group. Involved in the accumulation of anthocyanin and in root development
UniProtProbable transcription factor involved in the regulation of the tissue-specific accumulation of anthocyanins and in cellular organization of the primary root. {ECO:0000269|PubMed:10402424}.
Function -- GeneRIF ? help Back to Top
  1. In plants with an ANL2 gene mutation, extra (intervening) cells develop from epidermal cells but become cortical in nature, and expression of some epidermis-specific genes is abnormal.
    [PMID: 21421418]
  2. ANTHOCYANINLESS2 (ANL2), a gene involved in the regulation of cell wall mechanical properties, was identified.
    [PMID: 26720211]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00421DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT4G00730.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Disruption Phenotype ? help Back to Top
Source Description
UniProtDISRUPTION PHENOTYPE: Plants display a strong reduction of anthocyanin content on the adaxial side of rosette leaves, a slight reduction onf the abaxial side, and extra cells between cortical and epidermal layers in roots. {ECO:0000269|PubMed:10402424}.
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT4G00730
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2269680.0AK226968.1 Arabidopsis thaliana mRNA for homeodomain protein AHDP, complete cds, clone: RAFL09-36-B10.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_567183.20.0Homeobox-leucine zipper family protein / lipid-binding START domain-containing protein
SwissprotQ0WV120.0ANL2_ARATH; Homeobox-leucine zipper protein ANTHOCYANINLESS 2
TrEMBLA0A178V6U40.0A0A178V6U4_ARATH; ANL2
STRINGAT4G00730.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM112827105
Representative plantOGRP14515136
Publications ? help Back to Top
  1. Kubo H,Peeters AJ,Aarts MG,Pereira A,Koornneef M
    ANTHOCYANINLESS2, a homeobox gene affecting anthocyanin distribution and root development in Arabidopsis.
    Plant Cell, 1999. 11(7): p. 1217-26
    [PMID:10402424]
  2. Tavares R,Aubourg S,Lecharny A,Kreis M
    Organization and structural evolution of four multigene families in Arabidopsis thaliana: AtLCAD, AtLGT, AtMYST and AtHD-GL2.
    Plant Mol. Biol., 2000. 42(5): p. 703-17
    [PMID:10809443]
  3. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  4. Vlieghe K, et al.
    Microarray analysis of E2Fa-DPa-overexpressing plants uncovers a cross-talking genetic network between DNA replication and nitrogen assimilation.
    J. Cell. Sci., 2003. 116(Pt 20): p. 4249-59
    [PMID:12953064]
  5. Dal Bosco C, et al.
    Inactivation of the chloroplast ATP synthase gamma subunit results in high non-photochemical fluorescence quenching and altered nuclear gene expression in Arabidopsis thaliana.
    J. Biol. Chem., 2004. 279(2): p. 1060-9
    [PMID:14576160]
  6. Schrick K,Nguyen D,Karlowski WM,Mayer KF
    START lipid/sterol-binding domains are amplified in plants and are predominantly associated with homeodomain transcription factors.
    Genome Biol., 2004. 5(6): p. R41
    [PMID:15186492]
  7. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  8. Solfanelli C,Poggi A,Loreti E,Alpi A,Perata P
    Sucrose-specific induction of the anthocyanin biosynthetic pathway in Arabidopsis.
    Plant Physiol., 2006. 140(2): p. 637-46
    [PMID:16384906]
  9. Nakamura M, et al.
    Characterization of the class IV homeodomain-Leucine Zipper gene family in Arabidopsis.
    Plant Physiol., 2006. 141(4): p. 1363-75
    [PMID:16778018]
  10. Lindqvist C, et al.
    An expressed sequence tag (EST) library from developing fruits of an Hawaiian endemic mint (Stenogyne rugosa, Lamiaceae): characterization and microsatellite markers.
    BMC Plant Biol., 2006. 6: p. 16
    [PMID:16928278]
  11. Sivitz AB,Reinders A,Ward JM
    Arabidopsis sucrose transporter AtSUC1 is important for pollen germination and sucrose-induced anthocyanin accumulation.
    Plant Physiol., 2008. 147(1): p. 92-100
    [PMID:18359840]
  12. Hanada K, et al.
    Functional compensation of primary and secondary metabolites by duplicate genes in Arabidopsis thaliana.
    Mol. Biol. Evol., 2011. 28(1): p. 377-82
    [PMID:20736450]
  13. Kubo H,Hayashi K
    Characterization of root cells of anl2 mutant in Arabidopsis thaliana.
    Plant Sci., 2011. 180(5): p. 679-85
    [PMID:21421418]
  14. Nadakuduti SS, et al.
    Pleiotropic phenotypes of the sticky peel mutant provide new insight into the role of CUTIN DEFICIENT2 in epidermal cell function in tomato.
    Plant Physiol., 2012. 159(3): p. 945-60
    [PMID:22623518]
  15. Mabuchi A,Soga K,Wakabayashi K,Hoson T
    Phenotypic screening of Arabidopsis T-DNA insertion lines for cell wall mechanical properties revealed ANTHOCYANINLESS2, a cell wall-related gene.
    J. Plant Physiol., 2016. 191: p. 29-35
    [PMID:26720211]
  16. Lu P,Porat R,Nadeau JA,O'Neill SD
    Identification of a meristem L1 layer-specific gene in Arabidopsis that is expressed during embryonic pattern formation and defines a new class of homeobox genes.
    Plant Cell, 1996. 8(12): p. 2155-68
    [PMID:8989876]