PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT4G00390.1
Common NameA_IG005I10.6, F5I10.6
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family GeBP
Protein Properties Length: 364aa    MW: 39209.4 Da    PI: 6.0481
Description DNA-binding storekeeper protein-related transcriptional regulator
Gene Model
Gene Model ID Type Source Coding Sequence
AT4G00390.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF573130.75.5e-41156247297
       DUF573   2 lfqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifelskkiWg 97 
                  lfqrlws++Dei++LqG+id++a+tgksps+d++afyef kksisf+vsksq+++K+r+L+kK++ k+ k    +ep+f k+hd+k+felsk iWg
  AT4G00390.1 156 LFQRLWSDDDEISMLQGMIDYHADTGKSPSADTNAFYEFQKKSISFEVSKSQFSDKVRSLRKKYRAKEGK----DEPRFVKAHDKKAFELSKFIWG 247
                  69********************************************************************....9********************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045041.3E-31157247IPR007592Protein of unknown function DUF573
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005730Cellular Componentnucleolus
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009010anatomyseed
PO:0001078developmental stageplant embryo cotyledonary stage
Sequence ? help Back to Top
Protein Sequence    Length: 364 aa     Download sequence    Send to blast
MTKKLDPPTA PSSDEDDVET SEDDSSSSEE DEPIKSLPAT TAAAPAKSTA VSAATPAKST  60
SVSAAAPSKS TAVSAAADSD SGSESETDSD SESTDPPKSG SGKTIASKKK DDPSSSTATL  120
ALPAVKSGAK RAASEAATTS TKRVKKDEES VKKPALFQRL WSDDDEISML QGMIDYHADT  180
GKSPSADTNA FYEFQKKSIS FEVSKSQFSD KVRSLRKKYR AKEGKDEPRF VKAHDKKAFE  240
LSKFIWGPKG IALDSNAKSN GVSKKSASKT KEKLDSVKQD LAFVGVSSTN GDDWFEKSSL  300
ARMIAGSGID EYYVRQKWSS FTLETKKIVE EKFQLMQAKE LEAMLDKSVR LTDLTSYFVD  360
ASKN
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.345650.0flower
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO184113200.0
Genevisible255666_at0.0
Expression AtlasAT4G00390-
AtGenExpressAT4G00390-
ATTED-IIAT4G00390-
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT4G00390.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT4G00390
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankF5I100.0AF195115.1 Arabidopsis thaliana BAC F5I10.
GenBankIG005I100.0AF013293.1 Arabidopsis thaliana BAC IG005I10.
GenBankCP0026870.0CP002687.1 Arabidopsis thaliana chromosome 4 sequence.
GenBankAL1614710.0AL161471.2 Arabidopsis thaliana DNA chromosome 4, contig fragment No. 1.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_191949.10.0DNA-binding storekeeper protein-related transcriptional regulator
TrEMBLO230630.0O23063_ARATH; A_IG005I10.6 protein
STRINGAT4G00390.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP4222523
MalvidsOGEM31328181
Publications ? help Back to Top
  1. Curaba J,Herzog M,Vachon G
    GeBP, the first member of a new gene family in Arabidopsis, encodes a nuclear protein with DNA-binding activity and is regulated by KNAT1.
    Plant J., 2003. 33(2): p. 305-17
    [PMID:12535344]
  2. Pendle AF, et al.
    Proteomic analysis of the Arabidopsis nucleolus suggests novel nucleolar functions.
    Mol. Biol. Cell, 2005. 16(1): p. 260-9
    [PMID:15496452]
  3. Eubel H, et al.
    Novel proteins, putative membrane transporters, and an integrated metabolic network are revealed by quantitative proteomic analysis of Arabidopsis cell culture peroxisomes.
    Plant Physiol., 2008. 148(4): p. 1809-29
    [PMID:18931141]
  4. Hanada K, et al.
    Functional compensation of primary and secondary metabolites by duplicate genes in Arabidopsis thaliana.
    Mol. Biol. Evol., 2011. 28(1): p. 377-82
    [PMID:20736450]