PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT4G00260.1
Common NameF5I10.15, MEE45, REM15.15
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family B3
Protein Properties Length: 528aa    MW: 60034.8 Da    PI: 9.1874
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT4G00260.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B348.51.5e-1514921297
                 HTT-EE--HHH.HTT.---..--SEEEEEE.TTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE CS
           B3 12 ksgrlvlpkkfaeeh.ggkkeesktltled.esgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvf 97
                  ++ l++p  f+ ++ +g   e+kt +l++  s r+Wevk+  ++++    lt+GWkeF+ +++L+ gD+vvF+  ++s+  ++v+++
  AT4G00260.1 14 FHASLTIPVAFFLKYiEGR-YEQKTAKLRSdASKRTWEVKI--DGQR----LTDGWKEFAVSHDLRIGDIVVFR--QESDLAFHVTLL 92
                 45669**********7444.45679999987889*******..9888....***********************..557776688765 PP

2B367.32.2e-21138227496
                  E-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEE CS
           B3   4 vltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkv 96 
                  + + +++l+ +++++p+ f++++g +  +s +++l++e+grsW+++l+ + + g+++ ++GW +F++angLk+gD  +Fkl++ + ++lv+++
  AT4G00260.1 138 ANVAPSSLRYDLMRFPRGFVRDNGVV--GSGEIVLMNEKGRSWNFNLRQKPSNGTVYVRGGWVSFCDANGLKAGDNYTFKLIK-RAGTLVLRL 227
                  567889999**************977..7779***************99999999***************************9.555567666 PP

3B373.13.3e-23282373497
                  E-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE CS
           B3   4 vltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvf 97 
                  + +++++l+ + l+lpk+f++e+g +k+++ +++l +e+g+sW++ l+++k+sg+ ++++GW++F++angL++g ++++kl++ ++++lv++++
  AT4G00260.1 282 ANVSPSSLRYDTLYLPKRFMRENGVDKRCG-EMILINEKGKSWTLDLKVKKSSGTSLIKRGWRSFCSANGLRAGSIITLKLIK-KRATLVLRLI 373
                  5678899999*************9999998.**************************************************98.7777787765 PP

4B354.12.9e-174415221799
                  E--HHH.HTT---..--SEEEEEETTS-EEEEEE...EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
           B3  17 vlpkkfaeehggkkeesktltledesgrsWevkliy.rkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99 
                  +lp +f++ +g+++e  +++tl d++g +W  +l++ + k++r  + +GW++F +an++k++++++++l++++e+++v+k+++k
  AT4G00260.1 441 RLPVPFTRMNGINEE--TKMTLLDKHGVKWLTTLRFeDDKRKRLRMVGGWQGFIQANDVKANESIMLELIWEEETSCVLKFCSK 522
                  89********99954..58*****************988888999************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5086312.266395IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.105.5E-213107IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.08E-174102IPR015300DNA-binding pseudobarrel domain
CDDcd100175.31E-15592No hitNo description
SMARTSM010194.0E-21695IPR003340B3 DNA binding domain
PfamPF023621.8E-101589IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.103.5E-21128225IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019365.49E-22131233IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086316.863135231IPR003340B3 DNA binding domain
CDDcd100176.35E-20135229No hitNo description
SMARTSM010191.8E-29136231IPR003340B3 DNA binding domain
PfamPF023622.4E-20137228IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.107.4E-22272371IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.06E-21275378IPR015300DNA-binding pseudobarrel domain
CDDcd100173.78E-21279374No hitNo description
PROSITE profilePS5086315.763279376IPR003340B3 DNA binding domain
SMARTSM010192.6E-28280376IPR003340B3 DNA binding domain
PfamPF023625.8E-21281374IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.105.6E-17410522IPR015300DNA-binding pseudobarrel domain
SMARTSM010194.2E-20414523IPR003340B3 DNA binding domain
PROSITE profilePS5086311.406425522IPR003340B3 DNA binding domain
CDDcd100171.53E-12428520No hitNo description
SuperFamilySSF1019364.51E-15438521IPR015300DNA-binding pseudobarrel domain
PfamPF023622.2E-15441522IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009793Biological Processembryo development ending in seed dormancy
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 528 aa     Download sequence    Send to blast
MAHQHFFKPL LPGFHASLTI PVAFFLKYIE GRYEQKTAKL RSDASKRTWE VKIDGQRLTD  60
GWKEFAVSHD LRIGDIVVFR QESDLAFHVT LLGPSCCGIQ YGSCSVEKNN LGDEKKKVKE  120
NPNGEAESSS RDPSCFVANV APSSLRYDLM RFPRGFVRDN GVVGSGEIVL MNEKGRSWNF  180
NLRQKPSNGT VYVRGGWVSF CDANGLKAGD NYTFKLIKRA GTLVLRLLPN EPKEEANEVS  240
LPEEPESDAE RNLEKIQRKE KVKKNVTREA ESSSQDPSCF VANVSPSSLR YDTLYLPKRF  300
MRENGVDKRC GEMILINEKG KSWTLDLKVK KSSGTSLIKR GWRSFCSANG LRAGSIITLK  360
LIKKRATLVL RLIPNEPEEA NEVVSLSTEQ ESDEESIHDE KISRRKSLLS ENRFVTLTLT  420
PYTIQSSLLN ENLLCESMFQ RLPVPFTRMN GINEETKMTL LDKHGVKWLT TLRFEDDKRK  480
RLRMVGGWQG FIQANDVKAN ESIMLELIWE EETSCVLKFC SKVKLEIK
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1256263QRKEKVKK
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO425661810.0
Genevisible257436_s_at1e-107
Expression AtlasAT4G00260-
AtGenExpressAT4G00260-
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT4G00260.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT4G00260
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1175140.0AK117514.1 Arabidopsis thaliana At2g24650 mRNA for unknown protein, complete cds, clone: RAFL17-15-N14.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_567162.20.0Transcriptional factor B3 family protein
SwissprotO230760.0REM15_ARATH; Putative B3 domain-containing protein REM15
TrEMBLA0A178V1U90.0A0A178V1U9_ARATH; MEE45
STRINGAT4G00260.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM20422261
Representative plantOGRP2682231
Publications ? help Back to Top
  1. Pagnussat GC, et al.
    Genetic and molecular identification of genes required for female gametophyte development and function in Arabidopsis.
    Development, 2005. 132(3): p. 603-14
    [PMID:15634699]
  2. Swaminathan K,Peterson K,Jack T
    The plant B3 superfamily.
    Trends Plant Sci., 2008. 13(12): p. 647-55
    [PMID:18986826]
  3. Mantegazza O, et al.
    Analysis of the arabidopsis REM gene family predicts functions during flower development.
    Ann. Bot., 2014. 114(7): p. 1507-15
    [PMID:25002525]