PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT3G62420.1
Common NameATBZIP53, BZIP53, T12C14.120
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family bZIP
Protein Properties Length: 146aa    MW: 16805.1 Da    PI: 5.0746
Description basic region/leucine zipper motif 53
Gene Model
Gene Model ID Type Source Coding Sequence
AT3G62420.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_141.23.6e-132583563
                 CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1  5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63
                 ++ +r+++NRe+ArrsR RK++++  L ++v  L++ N +  ++++e +k++ +++s++
  AT3G62420.1 25 RKRKRMISNRESARRSRMRKQKQLGDLINEVTLLKNDNAKITEQVDEASKKYIEMESKN 83
                 6789***************************************************9998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003384.1E-152185IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.6452386IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.01E-112576No hitNo description
PfamPF001708.5E-122583IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1707.9E-112576No hitNo description
CDDcd147022.53E-162676No hitNo description
PROSITE patternPS0003602843IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006971Biological Processhypotonic response
GO:0009267Biological Processcellular response to starvation
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000693Biological Processpositive regulation of seed maturation
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0045735Molecular Functionnutrient reservoir activity
GO:0046982Molecular Functionprotein heterodimerization activity
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000293anatomyguard cell
PO:0025195anatomypollen tube cell
PO:0025281anatomypollen
PO:0001016developmental stageL mature pollen stage
PO:0001017developmental stageM germinated pollen stage
Sequence ? help Back to Top
Protein Sequence    Length: 146 aa     Download sequence    Send to blast
MGSLQMQTSP ESDNDPRYAT VTDERKRKRM ISNRESARRS RMRKQKQLGD LINEVTLLKN  60
DNAKITEQVD EASKKYIEME SKNNVLRAQA SELTDRLRSL NSVLEMVEEI SGQALDIPEI  120
PESMQNPWQM PCPMQPIRAS ADMFDC
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
12445RKRKRMISNRESARRSRMRKQK
23744RRSRMRKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.487980.0flower| root| seed| silique
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1865113390.0
Genevisible251237_at0.0
Expression AtlasAT3G62420-
AtGenExpressAT3G62420-
ATTED-IIAT3G62420-
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: In developing seeds, accumulates in embryo cotyledons during late maturation, from the torpedo to the green cotyledon stages. Also present in endosperm. {ECO:0000269|PubMed:19531597}.
UniprotTISSUE SPECIFICITY: Expressed in developing seeds. {ECO:0000269|PubMed:19531597}.
Functional Description ? help Back to Top
Source Description
TAIREncodes a group-S bZIP transcription factor. Forms heterodimers with group-C bZIP transcription factors. The heterodimers bind to the ACTCAT cis-element of proline dehydrogenase gene.
UniProtTranscription activator that binds DNA to the C-box-like motif (5'-TGCTGACGTCA-3'), ABRE elements, G-box-like motif (5'-CCACGTGGCC-3'), DOF (5'-AAAG-3'), I-box (5'-GATAA-3'), BS1 (5'-AGCGGG-3'), MY3 (5'-CGACG-3'), 5'-CAGTGCGC-3' and 5'-ACTCAT-3' sequence in target gene promoters (PubMed:15047879, PubMed:16810321, PubMed:19531597, PubMed:21278122, PubMed:25108460). DNA-binding and subsequent transcription activation is triggered by heterodimerization with other bZIP proteins (e.g. BZIP1, BZIP10 and BZIP25) (PubMed:16810321, PubMed:19531597, PubMed:21278122). Promotes POX1/PRODH1 expression in response to hypoosmolarity stress (PubMed:15047879, PubMed:16810321). Transcriptional activator of seed maturation (MAT) genes (e.g. AT2S2), including seed storage protein (SSP) and late embryogenesis abundant (LEA) genes (PubMed:19531597). Activated by low energy stress both by transcriptional and post-transcriptional mechanisms. Promotes dark-induced senescence and participates in the transcriptional reprogramming of amino acid metabolism during the dark-induced starvation response, especially when heterodimerized with BZIP1, by triggering accumulation of sepcific proteins including ASN1 and POX1/PRODH1 (PubMed:21278122). {ECO:0000269|PubMed:15047879, ECO:0000269|PubMed:16810321, ECO:0000269|PubMed:19531597, ECO:0000269|PubMed:21278122, ECO:0000269|PubMed:25108460}.
Function -- GeneRIF ? help Back to Top
  1. Heterodimers containing bZIP53 participate in enhanceosome formation to produce a dramatic increase in seed maturation gene transcription.
    [PMID: 19531597]
  2. bZIP1 and bZIP53 expression is enhanced during dark-induced starvation. Heterodimerization with members of the partially redundant C/S1 bZIP factor network reprograms primary metabolism in the starvation response.
    [PMID: 21278122]
  3. Data show that the group S1 basic leucine zipper transcription factors bZIP1 and bZIP53 reprogram primary C- and N-metabolism.
    [PMID: 26276836]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00419DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT3G62420.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By hypoosmolarity (PubMed:15047879, PubMed:16810321). Accumulates during dark-induced starvation (PubMed:21278122). {ECO:0000269|PubMed:15047879, ECO:0000269|PubMed:16810321, ECO:0000269|PubMed:21278122}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top
Source Target Gene (A: Activate/R: Repress)
ATRM AT3G30775(A), AT5G65165(A)
Interaction ? help Back to Top
Source Intact With
BioGRIDAT4G02640, AT4G34590, AT5G24800, AT5G28770, AT1G13600, AT1G75390
IntActSearch Q9LZP8
Phenotype -- Disruption Phenotype ? help Back to Top
Source Description
UniProtDISRUPTION PHENOTYPE: Reduced seed maturation (MAT) genes expression (PubMed:19531597). Slight reduction in the dark-induced activation of POX1/PRODH1 transcript accumulation (PubMed:21278122). {ECO:0000269|PubMed:19531597, ECO:0000269|PubMed:21278122}.
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT3G62420
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0026860.0CP002686.1 Arabidopsis thaliana chromosome 3, complete sequence.
GenBankAY0914210.0AY091421.1 Arabidopsis thaliana putative bZIP transcription factor (At3g62420) mRNA, complete cds.
GenBankAY0509230.0AY050923.1 Arabidopsis thaliana putative bZIP transcription factor (At3g62420) mRNA, complete cds.
GenBankAL1625070.0AL162507.1 Arabidopsis thaliana DNA chromosome 3, BAC clone T12C14.
GenBankAF4006200.0AF400620.1 Arabidopsis thaliana transcription factor-like protein bZIP53 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_191801.11e-104basic region/leucine zipper motif 53 protein
SwissprotQ9LZP81e-106BZP53_ARATH; bZIP transcription factor 53
TrEMBLD7LT651e-102D7LT65_ARALL; ATBZIP53
STRINGAT3G62420.11e-103(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5511678
MalvidsOGEM30362763
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Jakoby M, et al.
    bZIP transcription factors in Arabidopsis.
    Trends Plant Sci., 2002. 7(3): p. 106-11
    [PMID:11906833]
  3. Lara P, et al.
    Synergistic activation of seed storage protein gene expression in Arabidopsis by ABI3 and two bZIPs related to OPAQUE2.
    J. Biol. Chem., 2003. 278(23): p. 21003-11
    [PMID:12657652]
  4. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  5. Satoh R,Fujita Y,Nakashima K,Shinozaki K,Yamaguchi-Shinozaki K
    A novel subgroup of bZIP proteins functions as transcriptional activators in hypoosmolarity-responsive expression of the ProDH gene in Arabidopsis.
    Plant Cell Physiol., 2004. 45(3): p. 309-17
    [PMID:15047879]
  6. Wiese A,Elzinga N,Wobbes B,Smeekens S
    A conserved upstream open reading frame mediates sucrose-induced repression of translation.
    Plant Cell, 2004. 16(7): p. 1717-29
    [PMID:15208401]
  7. Deppmann CD, et al.
    Dimerization specificity of all 67 B-ZIP motifs in Arabidopsis thaliana: a comparison to Homo sapiens B-ZIP motifs.
    Nucleic Acids Res., 2004. 32(11): p. 3435-45
    [PMID:15226410]
  8. Ehlert A, et al.
    Two-hybrid protein-protein interaction analysis in Arabidopsis protoplasts: establishment of a heterodimerization map of group C and group S bZIP transcription factors.
    Plant J., 2006. 46(5): p. 890-900
    [PMID:16709202]
  9. Deppmann CD,Alvania RS,Taparowsky EJ
    Cross-species annotation of basic leucine zipper factor interactions: Insight into the evolution of closed interaction networks.
    Mol. Biol. Evol., 2006. 23(8): p. 1480-92
    [PMID:16731568]
  10. Weltmeier F, et al.
    Combinatorial control of Arabidopsis proline dehydrogenase transcription by specific heterodimerisation of bZIP transcription factors.
    EMBO J., 2006. 25(13): p. 3133-43
    [PMID:16810321]
  11. Filatov V, et al.
    Comparison of gene expression in segregating families identifies genes and genomic regions involved in a novel adaptation, zinc hyperaccumulation.
    Mol. Ecol., 2006. 15(10): p. 3045-59
    [PMID:16911220]
  12. Baxter CJ, et al.
    The metabolic response of heterotrophic Arabidopsis cells to oxidative stress.
    Plant Physiol., 2007. 143(1): p. 312-25
    [PMID:17122072]
  13. Popescu SC, et al.
    Differential binding of calmodulin-related proteins to their targets revealed through high-density Arabidopsis protein microarrays.
    Proc. Natl. Acad. Sci. U.S.A., 2007. 104(11): p. 4730-5
    [PMID:17360592]
  14. Cheng C, et al.
    An early response regulatory cluster induced by low temperature and hydrogen peroxide in seedlings of chilling-tolerant japonica rice.
    BMC Genomics, 2007. 8: p. 175
    [PMID:17577400]
  15. Hayden CA,Jorgensen RA
    Identification of novel conserved peptide uORF homology groups in Arabidopsis and rice reveals ancient eukaryotic origin of select groups and preferential association with transcription factor-encoding genes.
    BMC Biol., 2007. 5: p. 32
    [PMID:17663791]
  16. Usadel B, et al.
    Global transcript levels respond to small changes of the carbon status during progressive exhaustion of carbohydrates in Arabidopsis rosettes.
    Plant Physiol., 2008. 146(4): p. 1834-61
    [PMID:18305208]
  17. Ascencio-Ib
    Global analysis of Arabidopsis gene expression uncovers a complex array of changes impacting pathogen response and cell cycle during geminivirus infection.
    Plant Physiol., 2008. 148(1): p. 436-54
    [PMID:18650403]
  18. Wang Y, et al.
    Transcriptome analyses show changes in gene expression to accompany pollen germination and tube growth in Arabidopsis.
    Plant Physiol., 2008. 148(3): p. 1201-11
    [PMID:18775970]
  19. Roschzttardtz H, et al.
    A nuclear gene encoding the iron-sulfur subunit of mitochondrial complex II is regulated by B3 domain transcription factors during seed development in Arabidopsis.
    Plant Physiol., 2009. 150(1): p. 84-95
    [PMID:19261733]
  20. Alonso R, et al.
    A pivotal role of the basic leucine zipper transcription factor bZIP53 in the regulation of Arabidopsis seed maturation gene expression based on heterodimerization and protein complex formation.
    Plant Cell, 2009. 21(6): p. 1747-61
    [PMID:19531597]
  21. Dietrich K, et al.
    Heterodimers of the Arabidopsis transcription factors bZIP1 and bZIP53 reprogram amino acid metabolism during low energy stress.
    Plant Cell, 2011. 23(1): p. 381-95
    [PMID:21278122]
  22. Arabidopsis Interactome Mapping Consortium
    Evidence for network evolution in an Arabidopsis interactome map.
    Science, 2011. 333(6042): p. 601-7
    [PMID:21798944]
  23. Ji X, et al.
    A novel method to identify the DNA motifs recognized by a defined transcription factor.
    Plant Mol. Biol., 2014. 86(4-5): p. 367-80
    [PMID:25108460]
  24. Jin J, et al.
    An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors.
    Mol. Biol. Evol., 2015. 32(7): p. 1767-73
    [PMID:25750178]
  25. Hartmann L, et al.
    Crosstalk between Two bZIP Signaling Pathways Orchestrates Salt-Induced Metabolic Reprogramming in Arabidopsis Roots.
    Plant Cell, 2015. 27(8): p. 2244-60
    [PMID:26276836]