PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT3G61910.1
Common NameANAC066, F21F14.80, NAC066, NST2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family NAC
Protein Properties Length: 334aa    MW: 37861.7 Da    PI: 6.0435
Description NAC domain protein 66
Gene Model
Gene Model ID Type Source Coding Sequence
AT3G61910.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM164.92.9e-51111391128
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                  +ppGfrFhPt+eel+++yL+kk+++ k++l +vi+++d++k+ePwd+++  k+ +  +++wyf+s++dkky+tg+r+nrat+ g+Wkatg+dk++++ 
  AT3G61910.1  11 VPPGFRFHPTEEELLKYYLRKKISNIKIDL-DVIPDIDLNKLEPWDIQEmcKIGTtPQNDWYFYSHKDKKYPTGTRTNRATTVGFWKATGRDKTIYT- 106
                  69****************************.9***************962433332455**************************************. PP

          NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrl 128
                  +g  +g++ktLvfykgrap+g+k+dW+mheyrl
  AT3G61910.1 107 NGDRIGMRKTLVFYKGRAPHGQKSDWIMHEYRL 139
                  9999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.2E-558175IPR003441NAC domain
PROSITE profilePS5100554.61511175IPR003441NAC domain
PfamPF023656.8E-2712139IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009834Biological Processplant-type secondary cell wall biogenesis
GO:0009901Biological Processanther dehiscence
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0016020Cellular Componentmembrane
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000002anatomyanther wall
PO:0000056anatomyflower bud
PO:0000230anatomyinflorescence meristem
PO:0009025anatomyvascular leaf
PO:0009046anatomyflower
PO:0009052anatomyflower pedicel
PO:0025281anatomypollen
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 334 aa     Download sequence    Send to blast
MNISVNGQSQ VPPGFRFHPT EEELLKYYLR KKISNIKIDL DVIPDIDLNK LEPWDIQEMC  60
KIGTTPQNDW YFYSHKDKKY PTGTRTNRAT TVGFWKATGR DKTIYTNGDR IGMRKTLVFY  120
KGRAPHGQKS DWIMHEYRLD ESVLISSCGD HDVNVETCDV IGSDEGWVVC RVFKKNNLCK  180
NMISSSPASS VKTPSFNEET IEQLLEVMGQ SCKGEIVLDP FLKLPNLECH NNTTITSYQW  240
LIDDQVNNCH VSKVMDPSFI TSWAALDRLV ASQLNGPNSY SIPAVNETSQ SPYHGLNRSG  300
CNTGLTPDYY IPEIDLWNEA DFARTTCHLL NGSG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-45817714167NO APICAL MERISTEM PROTEIN
1ut4_B1e-45817714167NO APICAL MERISTEM PROTEIN
1ut7_A1e-45817714167NO APICAL MERISTEM PROTEIN
1ut7_B1e-45817714167NO APICAL MERISTEM PROTEIN
3swm_A9e-46817717170NAC domain-containing protein 19
3swm_B9e-46817717170NAC domain-containing protein 19
3swm_C9e-46817717170NAC domain-containing protein 19
3swm_D9e-46817717170NAC domain-containing protein 19
3swp_A9e-46817717170NAC domain-containing protein 19
3swp_B9e-46817717170NAC domain-containing protein 19
3swp_C9e-46817717170NAC domain-containing protein 19
3swp_D9e-46817717170NAC domain-containing protein 19
4dul_A1e-45817714167NAC domain-containing protein 19
4dul_B1e-45817714167NAC domain-containing protein 19
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO184121920.0
Genevisible251303_at0.0
Expression AtlasAT3G61910-
AtGenExpressAT3G61910-
ATTED-IIAT3G61910-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Mostly expressed in anthers. Also present in pollen, base of siliques and inflorescence stems. {ECO:0000269|PubMed:16214898}.
Functional Description ? help Back to Top
Source Description
TAIRNAC transcription factor NST2. NST1 and NST2 are redundant in regulating secondary wall thickening in anther walls. NST2 promoter was particularly strong in anther tissue.
UniProtTranscription activator of genes involved in biosynthesis of secondary walls. Together with NST1, required for the secondary cell wall thickening of the anther endocethium, which is necessary for anther dehiscence. May also regulate the secondary cell wall lignification of other tissues such as tracheary elements. {ECO:0000269|PubMed:16214898}.
Function -- GeneRIF ? help Back to Top
  1. These results demonstrate that NST2 together with SND1 and NST1 regulate secondary wall biosynthesis in fibers of stems.
    [PMID: 25751728]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00015PBM25378322Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT3G61910.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- ATRM (Manually Curated Upstream Regulators) ? help Back to Top
Source Upstream Regulator (A: Activate/R: Repress)
ATRM AT3G13890 (A)
Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top
Source Target Gene (A: Activate/R: Repress)
ATRM AT1G16490(A), AT1G28470(A), AT1G62990(A), AT1G79180(A), AT5G12870(A), AT5G56110(A)
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT3G61910
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0843230.0AY084323.1 Arabidopsis thaliana clone 103969 mRNA, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_191750.10.0NAC transcription factor NST2
SwissprotQ9M2740.0NAC66_ARATH; NAC domain-containing protein 66
TrEMBLD7LSQ70.0D7LSQ7_ARALL; Putative uncharacterized protein
STRINGAT3G61910.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1715800
MalvidsOGEM77828124
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Ooka H, et al.
    Comprehensive analysis of NAC family genes in Oryza sativa and Arabidopsis thaliana.
    DNA Res., 2003. 10(6): p. 239-47
    [PMID:15029955]
  3. Mitsuda N,Seki M,Shinozaki K,Ohme-Takagi M
    The NAC transcription factors NST1 and NST2 of Arabidopsis regulate secondary wall thickenings and are required for anther dehiscence.
    Plant Cell, 2005. 17(11): p. 2993-3006
    [PMID:16214898]
  4. Yang C, et al.
    Arabidopsis MYB26/MALE STERILE35 regulates secondary thickening in the endothecium and is essential for anther dehiscence.
    Plant Cell, 2007. 19(2): p. 534-48
    [PMID:17329564]
  5. Mitra SK,Gantt JA,Ruby JF,Clouse SD,Goshe MB
    Membrane proteomic analysis of Arabidopsis thaliana using alternative solubilization techniques.
    J. Proteome Res., 2007. 6(5): p. 1933-50
    [PMID:17432890]
  6. Ko JH,Yang SH,Park AH,Lerouxel O,Han KH
    ANAC012, a member of the plant-specific NAC transcription factor family, negatively regulates xylary fiber development in Arabidopsis thaliana.
    Plant J., 2007. 50(6): p. 1035-48
    [PMID:17565617]
  7. Zhong R,Richardson EA,Ye ZH
    The MYB46 transcription factor is a direct target of SND1 and regulates secondary wall biosynthesis in Arabidopsis.
    Plant Cell, 2007. 19(9): p. 2776-92
    [PMID:17890373]
  8. Zhong R,Lee C,Zhou J,McCarthy RL,Ye ZH
    A battery of transcription factors involved in the regulation of secondary cell wall biosynthesis in Arabidopsis.
    Plant Cell, 2008. 20(10): p. 2763-82
    [PMID:18952777]
  9. Zhou J,Lee C,Zhong R,Ye ZH
    MYB58 and MYB63 are transcriptional activators of the lignin biosynthetic pathway during secondary cell wall formation in Arabidopsis.
    Plant Cell, 2009. 21(1): p. 248-66
    [PMID:19122102]
  10. McCarthy RL,Zhong R,Ye ZH
    MYB83 is a direct target of SND1 and acts redundantly with MYB46 in the regulation of secondary cell wall biosynthesis in Arabidopsis.
    Plant Cell Physiol., 2009. 50(11): p. 1950-64
    [PMID:19808805]
  11. Zhong R,Lee C,Ye ZH
    Global analysis of direct targets of secondary wall NAC master switches in Arabidopsis.
    Mol Plant, 2010. 3(6): p. 1087-103
    [PMID:20935069]
  12. Jin J, et al.
    An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors.
    Mol. Biol. Evol., 2015. 32(7): p. 1767-73
    [PMID:25750178]
  13. Zhong R,Ye ZH
    The Arabidopsis NAC transcription factor NST2 functions together with SND1 and NST1 to regulate secondary wall biosynthesis in fibers of inflorescence stems.
    Plant Signal Behav, 2015. 10(2): p. e989746
    [PMID:25751728]