PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT3G61850.3
Common NameBBFA, DAG1, DOF3.7, F21F14.20
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family Dof
Protein Properties Length: 284aa    MW: 31542.9 Da    PI: 9.8563
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT3G61850.3genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof123.47.6e-3958118262
       zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                  ++++++cprC+stntkfCyynnysl+qPryfCk+CrryWt+GG+lrnvPvGg++rknk+ss
  AT3G61850.3  58 PQEKVNCPRCNSTNTKFCYYNNYSLTQPRYFCKGCRRYWTEGGSLRNVPVGGSSRKNKRSS 118
                  6899******************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074784.0E-3057116IPR003851Zinc finger, Dof-type
PfamPF027016.1E-3360116IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.70562116IPR003851Zinc finger, Dof-type
PROSITE patternPS01361064100IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009639Biological Processresponse to red or far red light
GO:0009845Biological Processseed germination
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
GO:0046872Molecular Functionmetal ion binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0003015anatomyprimary root differentiation zone
PO:0005417anatomyphloem
PO:0005679anatomyepidermis
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0020100anatomyhypocotyl
PO:0020124anatomyroot stele
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025257anatomyprimary root elongation zone
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 284 aa     Download sequence    Send to blast
MINVKPMEQM ISSTNNNTPQ QQPTFIATNT RPNATASNGG SGGNTNNTAT METRKARPQE  60
KVNCPRCNST NTKFCYYNNY SLTQPRYFCK GCRRYWTEGG SLRNVPVGGS SRKNKRSSTP  120
LASPSNPKLP DLNPPILFSS QIPNKSNKDL NLLSFPVMQD HHHHALELLR SNGVSSRGMN  180
TFLPGQMMDS NSVLYSSLGF PTMPDYKQSN NNLSFSIDHH QGIGHNTINS NQRAQDNNDD  240
MNGASRVLFP FSDMKELSST TQEKSHGNNT YWNGMFSNTG GSSW
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.9890.0root
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible251290_at0.0
Expression AtlasAT3G61850-
AtGenExpressAT3G61850-
ATTED-IIAT3G61850-
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Turned off in siliques when they reached full maturation. Not expressed in developing or mature embryos.
UniprotTISSUE SPECIFICITY: Expressed in the phloem of the mother plant, including in roots, stem, leaves and flowers, but not present in the seed and embryo. In maturing siliques, found all through the funiculus connecting the placenta to the ovule, but not in the ovule.
Functional Description ? help Back to Top
Source Description
TAIRZinc finger transcription factor of the Dof family involved in the control of seed germination.
UniProtTranscription factor specifically involved in the maternal control of seed germination. Regulates transcription by binding to a 5'-AA[AG]G-3' consensus core sequence. May ensure the inactivity of a component that would be activated to trigger germination as a consequence of red light perception.
Function -- GeneRIF ? help Back to Top
  1. Data show that AtGA3ox1 is directly regulated by DAG1, and suggest that DAG1 is not a direct regulatory target of PIL5.
    [PMID: 19874540]
  2. ELIP (EARLY LIGHT-INDUCED PROTEIN) genes of Arabidopsis are involved in seed germination and that they act downstream of the Dof protein DAG1, although they are not its direct regulatory targets.
    [PMID: 21299564]
  3. DAG1 and the DELLA protein GAI cooperate in negatively regulating the AtGA3ox1 gene
    [PMID: 24719470]
  4. GAI interacts with DAG1 in embryo development.
    [PMID: 25064446]
  5. DAG2 is a positive regulator of the light-mediated seed germination process, and particularly reveal that this protein plays its main role downstream of PIL5 and DAG1 in the phytochrome B (phyB)-mediated pathway.
    [PMID: 25850831]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT3G61850.3
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top
Source Target Gene (A: Activate/R: Repress)
ATRM AT1G15550(R)
Regulation -- Hormone ? help Back to Top
Source Hormone
AHDGibberellin
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT3G61850
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1173520.0AK117352.1 Arabidopsis thaliana At3g61850 mRNA for putative transcription factor BBFa, complete cds, clone: RAFL16-91-P20.
GenBankBT0331270.0BT033127.1 Arabidopsis thaliana unknown protein (At3g61850) mRNA, complete cds.
GenBankX979410.0X97941.2 A.thaliana mRNA for zinc finger protein DAG1 (BBFa).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_191744.10.0Dof-type zinc finger DNA-binding family protein
SwissprotQ433850.0DOF37_ARATH; Dof zinc finger protein DOF3.7
TrEMBLB4F7P40.0B4F7P4_ARATH; At3g61850
STRINGAT3G61850.40.0(Arabidopsis thaliana)
Publications ? help Back to Top
  1. Papi M, et al.
    Identification and disruption of an Arabidopsis zinc finger gene controlling seed germination.
    Genes Dev., 2000. 14(1): p. 28-33
    [PMID:10640273]
  2. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  3. Papi M, et al.
    Inactivation of the phloem-specific Dof zinc finger gene DAG1 affects response to light and integrity of the testa of Arabidopsis seeds.
    Plant Physiol., 2002. 128(2): p. 411-7
    [PMID:11842145]
  4. Seki M, et al.
    Functional annotation of a full-length Arabidopsis cDNA collection.
    Science, 2002. 296(5565): p. 141-5
    [PMID:11910074]
  5. Gualberti G, et al.
    Mutations in the Dof zinc finger genes DAG2 and DAG1 influence with opposite effects the germination of Arabidopsis seeds.
    Plant Cell, 2002. 14(6): p. 1253-63
    [PMID:12084825]
  6. Che P,Gingerich DJ,Lall S,Howell SH
    Global and hormone-induced gene expression changes during shoot development in Arabidopsis.
    Plant Cell, 2002. 14(11): p. 2771-85
    [PMID:12417700]
  7. Yanagisawa S
    The Dof family of plant transcription factors.
    Trends Plant Sci., 2002. 7(12): p. 555-60
    [PMID:12475498]
  8. Lee JY, et al.
    Transcriptional and posttranscriptional regulation of transcription factor expression in Arabidopsis roots.
    Proc. Natl. Acad. Sci. U.S.A., 2006. 103(15): p. 6055-60
    [PMID:16581911]
  9. Ascencio-Ib
    Global analysis of Arabidopsis gene expression uncovers a complex array of changes impacting pathogen response and cell cycle during geminivirus infection.
    Plant Physiol., 2008. 148(1): p. 436-54
    [PMID:18650403]
  10. Gabriele S, et al.
    The Dof protein DAG1 mediates PIL5 activity on seed germination by negatively regulating GA biosynthetic gene AtGA3ox1.
    Plant J., 2010. 61(2): p. 312-23
    [PMID:19874540]
  11. Brady SM, et al.
    A stele-enriched gene regulatory network in the Arabidopsis root.
    Mol. Syst. Biol., 2011. 7: p. 459
    [PMID:21245844]
  12. Rizza A,Boccaccini A,Lopez-Vidriero I,Costantino P,Vittorioso P
    Inactivation of the ELIP1 and ELIP2 genes affects Arabidopsis seed germination.
    New Phytol., 2011. 190(4): p. 896-905
    [PMID:21299564]
  13. Gaudinier A, et al.
    Enhanced Y1H assays for Arabidopsis.
    Nat. Methods, 2011. 8(12): p. 1053-5
    [PMID:22037706]
  14. Boccaccini A, et al.
    The DOF protein DAG1 and the DELLA protein GAI cooperate in negatively regulating the AtGA3ox1 gene.
    Mol Plant, 2014. 7(9): p. 1486-9
    [PMID:24719470]
  15. Boccaccini A, et al.
    Independent and interactive effects of DOF affecting germination 1 (DAG1) and the Della proteins GA insensitive (GAI) and Repressor of ga1-3 (RGA) in embryo development and seed germination.
    BMC Plant Biol., 2014. 14: p. 200
    [PMID:25064446]
  16. Jin J, et al.
    An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors.
    Mol. Biol. Evol., 2015. 32(7): p. 1767-73
    [PMID:25750178]
  17. Santopolo S, et al.
    DOF AFFECTING GERMINATION 2 is a positive regulator of light-mediated seed germination and is repressed by DOF AFFECTING GERMINATION 1.
    BMC Plant Biol., 2015. 15: p. 72
    [PMID:25850831]
  18. De Paolis A,Sabatini S,De Pascalis L,Costantino P,Capone I
    A rolB regulatory factor belongs to a new class of single zinc finger plant proteins.
    Plant J., 1996. 10(2): p. 215-23
    [PMID:8771779]