PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT3G61150.1
Common NameHDG1, HD-GL2-1, HDGL2-1, T20K12.50
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family HD-ZIP
Protein Properties Length: 808aa    MW: 88166.7 Da    PI: 6.6855
Description homeodomain GLABROUS 1
Gene Model
Gene Model ID Type Source Coding Sequence
AT3G61150.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox62.27.6e-20111166156
                  TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
     Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                  +++ +++t++q++ Le++F+++ +p++++r +L+++l+L+ rqVk+WFqNrR+++k
  AT3G61150.1 111 KKRYHRHTPKQIQDLESVFKECAHPDEKQRLDLSRRLNLDPRQVKFWFQNRRTQMK 166
                  688999***********************************************999 PP

2START186.71.2e-583205382206
                  HHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEEEEEEC CS
        START   2 laeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....kaetlevis 86 
                  la++a++elvk+a+ +ep+Wv+ss    e +n++e+ ++f++  +     + +ea+++ g v+ ++  lve+l+d+  +W e+++    + +t+e is
  AT3G61150.1 320 LALAAMDELVKMAQTREPLWVRSSdsgfEVLNQEEYDTSFSRCVGpkqdgFVSEASKEAGTVIINSLALVETLMDSE-RWAEMFPsmvsRTSTTEIIS 416
                  6899********************99**66666666666654333666789**************************.*******9999********* PP

                  TT.....EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEEEE-EE--SSXXH CS
        START  87 sg.....galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwvehvdlkgrlph 178
                  sg     gal+lm aelq+lsplvp R + f+R+++q+ +g+w++vdvS+ds ++ + sss+ R   lpSg+l+++++ng+skvtw+eh++++++++h
  AT3G61150.1 417 SGmggrnGALHLMHAELQLLSPLVPvRQVSFLRFCKQHAEGVWAVVDVSIDSIREGS-SSSCRR---LPSGCLVQDMANGYSKVTWIEHTEYDENHIH 510
                  ********************************************************9.777766...******************************* PP

                  HHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
        START 179 wllrslvksglaegaktwvatlqrqcek 206
                   l+r+l++ gla+ga +w+a+lqrqce+
  AT3G61150.1 511 RLYRPLLRCGLAFGAHRWMAALQRQCEC 538
                  **************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.1E-2085169IPR009057Homeodomain-like
SuperFamilySSF466892.92E-1999168IPR009057Homeodomain-like
PROSITE profilePS5007117.086108168IPR001356Homeobox domain
SMARTSM003891.9E-18109172IPR001356Homeobox domain
CDDcd000861.66E-17111168No hitNo description
PfamPF000461.8E-17111166IPR001356Homeobox domain
PROSITE patternPS000270143166IPR017970Homeobox, conserved site
PROSITE profilePS5084840.457310541IPR002913START domain
SuperFamilySSF559614.4E-31313538No hitNo description
CDDcd088759.77E-110314537No hitNo description
SMARTSM002341.8E-42319538IPR002913START domain
PfamPF018525.7E-51320538IPR002913START domain
SuperFamilySSF559612.06E-18567800No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048497Biological Processmaintenance of floral organ identity
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000084anatomyplant sperm cell
PO:0000230anatomyinflorescence meristem
PO:0000282anatomytrichome
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009001anatomyfruit
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0009067anatomyfilament
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020094anatomyplant egg cell
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007131developmental stageseedling development stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 808 aa     Download sequence    Send to blast
MNFNGFLDDG AGASKLLSDA PYNNHFSFSA VDTMLGSAAI APSQSLPFSS SGLSLGLQTN  60
GEMSRNGEIM ESNVSRKSSR GEDVESRSES DNAEAVSGDD LDTSDRPLKK KKRYHRHTPK  120
QIQDLESVFK ECAHPDEKQR LDLSRRLNLD PRQVKFWFQN RRTQMKTQIE RHENALLRQE  180
NDKLRAENMS VREAMRNPMC GNCGGPAVIG EISMEEQHLR IENSRLKDEL DRVCALTGKF  240
LGRSNGSHHI PDSALVLGVG VGSGGCNVGG GFTLSSPLLP QASPRFEISN GTGSGLVATV  300
NRQQPVSVSD FDQRSRYLDL ALAAMDELVK MAQTREPLWV RSSDSGFEVL NQEEYDTSFS  360
RCVGPKQDGF VSEASKEAGT VIINSLALVE TLMDSERWAE MFPSMVSRTS TTEIISSGMG  420
GRNGALHLMH AELQLLSPLV PVRQVSFLRF CKQHAEGVWA VVDVSIDSIR EGSSSSCRRL  480
PSGCLVQDMA NGYSKVTWIE HTEYDENHIH RLYRPLLRCG LAFGAHRWMA ALQRQCECLT  540
ILMSSTVSTS TNPSPINCNG RKSMLKLAKR MTDNFCGGVC ASSLQKWSKL NVGNVDEDVR  600
IMTRKSVNNP GEPPGIILNA ATSVWMPVSP RRLFDFLGNE RLRSEWDILS NGGPMKEMAH  660
IAKGHDRSNS VSLLRASAIN ANQSSMLILQ ETSIDAAGAV VVYAPVDIPA MQAVMNGGDS  720
AYVALLPSGF AILPNGQAGT QRCAAEERNS IGNGGCMEEG GSLLTVAFQI LVNSLPTAKL  780
TVESVETVNN LISCTVQKIK AALHCDST
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.212090.0flower| seed
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1453397250.0
Genevisible251310_at0.0
Expression AtlasAT3G61150-
AtGenExpressAT3G61150-
ATTED-IIAT3G61150-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in trichomes forming at the base of young leaves, in endodermal cell lines around emergent lateral roots and in the epidermal layer of the stamen filament. {ECO:0000269|PubMed:16778018}.
Functional Description ? help Back to Top
Source Description
TAIREncodes a homeobox-leucine zipper family protein belonging to the HD-ZIP IV family.
UniProtProbable transcription factor. {ECO:0000250}.
Function -- GeneRIF ? help Back to Top
  1. Rice and Arabidopsis CFL1 negatively regulate cuticle development by affecting the function of HDG1, which regulates the downstream genes BDG and FDH.
    [PMID: 21954461]
  2. Data suggest that presence of mediator complex subunits MED10a, MED28, and MED32 or changes in redox state affect DNA-binding capacity of GeBPL (GLABROUS1/GL1 enhancer-binding protein-like) at likely GLABROUS1/GL1 promoter.
    [PMID: 25877331]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00418DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT3G61150.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Interaction ? help Back to Top
Source Intact With
BioGRIDAT5G25390
IntActSearch Q9M2E8
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT3G61150
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0508660.0AY050866.1 Arabidopsis thaliana putative homeobox protein (At3g61150) mRNA, complete cds.
GenBankAY0967570.0AY096757.1 Arabidopsis thaliana putative homeobox protein (At3g61150) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_191674.10.0homeodomain GLABROUS 1
SwissprotQ9M2E80.0HDG1_ARATH; Homeobox-leucine zipper protein HDG1
TrEMBLA0A178V5Q40.0A0A178V5Q4_ARATH; HDG1
STRINGAT3G61150.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM112827105
Representative plantOGRP14515136
Publications ? help Back to Top
  1. Tavares R,Aubourg S,Lecharny A,Kreis M
    Organization and structural evolution of four multigene families in Arabidopsis thaliana: AtLCAD, AtLGT, AtMYST and AtHD-GL2.
    Plant Mol. Biol., 2000. 42(5): p. 703-17
    [PMID:10809443]
  2. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  3. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  4. Schrick K,Nguyen D,Karlowski WM,Mayer KF
    START lipid/sterol-binding domains are amplified in plants and are predominantly associated with homeodomain transcription factors.
    Genome Biol., 2004. 5(6): p. R41
    [PMID:15186492]
  5. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  6. Truman W,de Zabala MT,Grant M
    Type III effectors orchestrate a complex interplay between transcriptional networks to modify basal defence responses during pathogenesis and resistance.
    Plant J., 2006. 46(1): p. 14-33
    [PMID:16553893]
  7. Nakamura M, et al.
    Characterization of the class IV homeodomain-Leucine Zipper gene family in Arabidopsis.
    Plant Physiol., 2006. 141(4): p. 1363-75
    [PMID:16778018]
  8. Borges F, et al.
    Comparative transcriptomics of Arabidopsis sperm cells.
    Plant Physiol., 2008. 148(2): p. 1168-81
    [PMID:18667720]
  9. Jakoby MJ, et al.
    Transcriptional profiling of mature Arabidopsis trichomes reveals that NOECK encodes the MIXTA-like transcriptional regulator MYB106.
    Plant Physiol., 2008. 148(3): p. 1583-602
    [PMID:18805951]
  10. Wuest SE, et al.
    Arabidopsis female gametophyte gene expression map reveals similarities between plant and animal gametes.
    Curr. Biol., 2010. 20(6): p. 506-12
    [PMID:20226671]
  11. Arabidopsis Interactome Mapping Consortium
    Evidence for network evolution in an Arabidopsis interactome map.
    Science, 2011. 333(6042): p. 601-7
    [PMID:21798944]
  12. Wu R, et al.
    CFL1, a WW domain protein, regulates cuticle development by modulating the function of HDG1, a class IV homeodomain transcription factor, in rice and Arabidopsis.
    Plant Cell, 2011. 23(9): p. 3392-411
    [PMID:21954461]
  13. Li-Beisson Y, et al.
    Acyl-lipid metabolism.
    Arabidopsis Book, 2013. 11: p. e0161
    [PMID:23505340]
  14. Kamata N,Okada H,Komeda Y,Takahashi T
    Mutations in epidermis-specific HD-ZIP IV genes affect floral organ identity in Arabidopsis thaliana.
    Plant J., 2013. 75(3): p. 430-40
    [PMID:23590515]
  15. We
    Convergent targeting of a common host protein-network by pathogen effectors from three kingdoms of life.
    Cell Host Microbe, 2014. 16(3): p. 364-75
    [PMID:25211078]
  16. Horstman A, et al.
    AIL and HDG proteins act antagonistically to control cell proliferation.
    Development, 2015. 142(3): p. 454-64
    [PMID:25564655]
  17. Shaikhali J, et al.
    Biochemical and redox characterization of the mediator complex and its associated transcription factor GeBPL, a GLABROUS1 enhancer binding protein.
    Biochem. J., 2015. 468(3): p. 385-400
    [PMID:25877331]
  18. Tichtinsky G, et al.
    An evolutionary conserved group of plant GSK-3/shaggy-like protein kinase genes preferentially expressed in developing pollen.
    Biochim. Biophys. Acta, 1998. 1442(2-3): p. 261-73
    [PMID:9804971]