PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT3G60460.1
Common NameDUO1, MYB125, T8B10_120
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB
Protein Properties Length: 297aa    MW: 33649.6 Da    PI: 6.0755
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT3G60460.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding42.81.2e-131055146
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                     +g+W +eEde l++ vk++G+++W++I ++  + Rt+k+c++rw +
      AT3G60460.1 10 KGPWKAEEDEVLINHVKRYGPRDWSSIRSKGLLQRTGKSCRLRWVN 55
                     79*************************8887799**********87 PP

2Myb_DNA-binding40.46.9e-1366105344
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrw 44 
                      +++++E+   +++  ++G++ W++Ia +++ gRt++++k++w
      AT3G60460.1  66 KFSADEERTVIELQSEFGNK-WARIATYLP-GRTDNDVKNFW 105
                      79******************.*********.*********** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.608.8E-22458IPR009057Homeodomain-like
PROSITE profilePS5129421.325561IPR017930Myb domain
SuperFamilySSF466897.42E-288105IPR009057Homeodomain-like
SMARTSM007177.1E-11959IPR001005SANT/Myb domain
CDDcd001675.77E-111257No hitNo description
PfamPF139217.5E-121363No hitNo description
Gene3DG3DSA:1.10.10.601.3E-1759111IPR009057Homeodomain-like
PROSITE profilePS5129417.5762113IPR017930Myb domain
SMARTSM007176.7E-1263111IPR001005SANT/Myb domain
PfamPF002496.7E-1266105IPR001005SANT/Myb domain
CDDcd001678.37E-1066105No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0048235Biological Processpollen sperm cell differentiation
GO:0005634Cellular Componentnucleus
GO:0000981Molecular FunctionRNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001135Molecular Functiontranscription factor activity, RNA polymerase II transcription factor recruiting
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000084anatomyplant sperm cell
PO:0020097anatomygenerative cell
Sequence ? help Back to Top
Protein Sequence    Length: 297 aa     Download sequence    Send to blast
MEAKKEEIKK GPWKAEEDEV LINHVKRYGP RDWSSIRSKG LLQRTGKSCR LRWVNKLRPN  60
LKNGCKFSAD EERTVIELQS EFGNKWARIA TYLPGRTDND VKNFWSSRQK RLARILHNSS  120
DASSSSFNPK SSSSHRLKGK NVKPIRQSSQ GFGLVEEEVT VSSSCSQMVP YSSDQVGDEV  180
LRLPDLGVKL EHQPFAFGTD LVLAEYSDSQ NDANQQAISP FSPESRELLA RLDDPFYYDI  240
LGPADSSEPL FALPQPFFEP SPVPRRCRHV SKDEEADVFL DDFPADMFDQ VDPIPSP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-27711124126MYB TRANSFORMING PROTEIN
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasAT3G60460
AtGenExpressAT3G60460
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Strict spatial and temporal transcriptional activation leading to a specific expression in the male germline cells; this specific expression pattern is dependent of the regulatory region of DUO1 (ROD1) 5'-YAACYGY-3' in its promoter (PubMed:15694308, PubMed:27624837). First observed in the germ cell during or soon after engulfment by the vegetative cell, just after asymmetric division. In maturating pollen, accumulates in germ cells before mitosis and remains high in mature sperm cells. Expression persists during pollen development (PubMed:19300502). {ECO:0000269|PubMed:15694308, ECO:0000269|PubMed:19300502, ECO:0000269|PubMed:27624837}.
UniprotTISSUE SPECIFICITY: Confined to inflorescences, especially in stamens and pollen. {ECO:0000269|PubMed:15694308}.
Functional Description ? help Back to Top
Source Description
TAIREncodes an R2R3 myb transcription factor that is required for male gamete formation, specifically for entry of the generative cell into mitosis. Specifically expressed in the male germline.
UniProtTranscription activator that acts as a positive regulator of male germline development by promoting both gametic cell specification and cell cycle progression (PubMed:15694308, PubMed:15618418, PubMed:19300502, PubMed:21285328). Binds to canonical MYB sites 5'-AACCGTC-3', 5'-AAACCGC-3' and 5'-AACCGT-3' in promoters to trigger the expression of male germline-specific or enriched genes (e.g. MGH3, GEX2 and GCS1), including those required for fertilization (PubMed:21285328, PubMed:19300502). Required for sperm cell specification leading to pollen maturation by activating a germline-specific regulon (PubMed:21285328, PubMed:15694308, PubMed:15618418, PubMed:19300502). Involved in pollen mitosis entry at G2-M transition via the regulation of CYCB1-1, DAZ1 and DAZ2 expression (PubMed:15618418, PubMed:19300502, PubMed:24876252). {ECO:0000269|PubMed:15618418, ECO:0000269|PubMed:15694308, ECO:0000269|PubMed:19300502, ECO:0000269|PubMed:21285328, ECO:0000269|PubMed:24876252}.
Function -- GeneRIF ? help Back to Top
  1. DUO1 controls male gamete formation in plants. [DUO1]
    [PMID: 15694308]
  2. The DUO1 regulon has a major role in shaping the germline transcriptome and functions to commit progenitor germ cells to sperm cell differentiation.
    [PMID: 21285328]
  3. key promoter sequences required for the germline-specific regulation of DUO1 transcription, are identified.
    [PMID: 27624837]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT3G60460.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed by the microRNA 159 (miR159); the production of miR159 is stimulated by the anaphase promoting complex/cyclosome (APC/C) (PubMed:21441434). Activated by ARID1 in male germline cells via specific histone acetylation regulation (e.g. H3K9Ac) (PubMed:25057814). {ECO:0000269|PubMed:21441434, ECO:0000269|PubMed:25057814}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT3G60460
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF4694680.0AF469468.1 Arabidopsis thaliana putative transcription factor (MYB125) mRNA, complete cds.
GenBankHM7765210.0HM776521.1 Arabidopsis thaliana duo pollen 1 (DUO1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_191605.20.0myb-like HTH transcriptional regulator family protein
SwissprotA0A178VEK70.0DUO1_ARATH; Transcription factor DUO1
TrEMBLF4JBU20.0F4JBU2_ARATH; DUO1
STRINGAT3G60460.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM65512842
Representative plantOGRP5171784
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Jiang C,Gu X,Peterson T
    Identification of conserved gene structures and carboxy-terminal motifs in the Myb gene family of Arabidopsis and Oryza sativa L. ssp. indica.
    Genome Biol., 2004. 5(7): p. R46
    [PMID:15239831]
  3. Durbarry A,Vizir I,Twell D
    Male germ line development in Arabidopsis. duo pollen mutants reveal gametophytic regulators of generative cell cycle progression.
    Plant Physiol., 2005. 137(1): p. 297-307
    [PMID:15618418]
  4. Rotman N, et al.
    A novel class of MYB factors controls sperm-cell formation in plants.
    Curr. Biol., 2005. 15(3): p. 244-8
    [PMID:15694308]
  5. Mehrtens F,Kranz H,Bednarek P,Weisshaar B
    The Arabidopsis transcription factor MYB12 is a flavonol-specific regulator of phenylpropanoid biosynthesis.
    Plant Physiol., 2005. 138(2): p. 1083-96
    [PMID:15923334]
  6. Okada T,Bhalla PL,Singh MB
    Expressed sequence tag analysis of Lilium longiflorum generative cells.
    Plant Cell Physiol., 2006. 47(6): p. 698-705
    [PMID:16571618]
  7. Brownfield L, et al.
    A plant germline-specific integrator of sperm specification and cell cycle progression.
    PLoS Genet., 2009. 5(3): p. e1000430
    [PMID:19300502]
  8. Brownfield L, et al.
    Arabidopsis DUO POLLEN3 is a key regulator of male germline development and embryogenesis.
    Plant Cell, 2009. 21(7): p. 1940-56
    [PMID:19638475]
  9. Cominelli E,Tonelli C
    A new role for plant R2R3-MYB transcription factors in cell cycle regulation.
    Cell Res., 2009. 19(11): p. 1231-2
    [PMID:19881525]
  10. Borg M, et al.
    The R2R3 MYB transcription factor DUO1 activates a male germline-specific regulon essential for sperm cell differentiation in Arabidopsis.
    Plant Cell, 2011. 23(2): p. 534-49
    [PMID:21285328]
  11. Zheng B,Chen X,McCormick S
    The anaphase-promoting complex is a dual integrator that regulates both MicroRNA-mediated transcriptional regulation of cyclin B1 and degradation of Cyclin B1 during Arabidopsis male gametophyte development.
    Plant Cell, 2011. 23(3): p. 1033-46
    [PMID:21441434]
  12. Beale KM,Leydon AR,Johnson MA
    Gamete fusion is required to block multiple pollen tubes from entering an Arabidopsis ovule.
    Curr. Biol., 2012. 22(12): p. 1090-4
    [PMID:22608506]
  13. Zheng B,He H,Zheng Y,Wu W,McCormick S
    An ARID domain-containing protein within nuclear bodies is required for sperm cell formation in Arabidopsis thaliana.
    PLoS Genet., 2014. 10(7): p. e1004421
    [PMID:25057814]
  14. Peters B, et al.
    A Conserved cis-Regulatory Module Determines Germline Fate through Activation of the Transcription Factor DUO1 Promoter.
    Plant Physiol., 2017. 173(1): p. 280-293
    [PMID:27624837]
  15. Zheng Z, et al.
    Target RNA Secondary Structure Is a Major Determinant of miR159 Efficacy.
    Plant Physiol., 2017. 174(3): p. 1764-1778
    [PMID:28515145]