PlantTFDB
Plant Transcription Factor Database
PlantRegMap/PlantTFDB v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT3G60390.1
Common NameHAT3, T8B10_50
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family HD-ZIP
Protein Properties Length: 315aa    MW: 34747.1 Da    PI: 8.3772
Description homeobox-leucine zipper protein 3
Gene Model
Gene Model ID Type Source Coding Sequence
AT3G60390.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.61.1e-18161215256
                  T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
     Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                  rk+ +++keq  +Lee F+++++++ +++  LAk+l+L +rqV vWFqNrRa+ k
  AT3G60390.1 161 RKKLRLSKEQALVLEETFKEHSTLNPKQKMALAKQLNLRTRQVEVWFQNRRARTK 215
                  788899***********************************************98 PP

2HD-ZIP_I/II122.81.6e-39161250191
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                  +kk+rlskeq+ +LEe+F+e+++L+p++K++la++L+l++rqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l++en+rL+kev+eLr +l
  AT3G60390.1 161 RKKLRLSKEQALVLEETFKEHSTLNPKQKMALAKQLNLRTRQVEVWFQNRRARTKLKQTEVDCEYLKRCCENLTDENRRLQKEVSELR-AL 250
                  69*************************************************************************************9.55 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046181.2E-361118IPR006712HD-ZIP protein, N-terminal
SuperFamilySSF466895.13E-19143218IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.2E-19144215IPR009057Homeodomain-like
PROSITE profilePS5007117.427157217IPR001356Homeobox domain
SMARTSM003895.1E-15159221IPR001356Homeobox domain
CDDcd000864.29E-15161218No hitNo description
PfamPF000464.0E-16161215IPR001356Homeobox domain
PROSITE patternPS000270192215IPR017970Homeobox, conserved site
PfamPF021836.0E-11217251IPR003106Leucine zipper, homeobox-associated
SMARTSM003401.1E-26217260IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000021anatomypetal primordium
PO:0000037anatomyshoot apex
PO:0000084anatomyplant sperm cell
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0004704anatomysepal primordium
PO:0008019anatomyleaf lamina base
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 315 aa     Download sequence    Send to blast
MSERDDGLGL SLSLSLGFNQ KDPSSRLNPM PLASYASSSH MQHMQQSNYN HPQKIQNTWI  60
NMFQSSERNS DMRSFLRGID VNRAPSTVVV DVEDEGAGVS SPNSTVSSVM SGKKSERELM  120
AAAGAVGGGR VEDNEIERAS CSLGGGSDDE DGSGNGDDSS RKKLRLSKEQ ALVLEETFKE  180
HSTLNPKQKM ALAKQLNLRT RQVEVWFQNR RARTKLKQTE VDCEYLKRCC ENLTDENRRL  240
QKEVSELRAL KLSPHLYMHM KPPTTLTMCP SCERVAVTSS SSSVAPPVMN SSSPMGPMSP  300
WAAMPLRQRP AAGSH
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1159165SRKKLRL
2209217RRARTKLKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.211120.0flower
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO306951910.0
Genevisible251374_at0.0
Expression AtlasAT3G60390-
AtGenExpressAT3G60390-
ATTED-IIAT3G60390-
Functional Description ? help Back to Top
Source Description
TAIREncodes homeobox protein HAT3.
UniProtProbable transcription factor. {ECO:0000250}.
Function -- GeneRIF ? help Back to Top
  1. ATHB4 and HAT3, two class II HD-ZIP transcription factors, control leaf development in Arabidopsis.
    [PMID: 22918502]
  2. The authors show that leaf orientation, morphology and position are pre-patterned by HAT3 and KAN gene expression in the shoot, leading to a model in which dorsoventral genes coordinate to regulate plant development by localizing auxin response between their expression domains.
    [PMID: 28895530]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT3G60390.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Interaction ? help Back to Top
Source Intact With
BioGRIDAT4G16780, AT4G37790, AT5G06710, AT5G47370
IntActSearch P46602
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT3G60390
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ4407810.0AJ440781.1 Arabidopsis thaliana mRNA for homeodomain-leucine zipper protein HAT3 (hat3 gene).
GenBankAY0995650.0AY099565.1 Arabidopsis thaliana homeobox-leucine zipper protein HAT3 (At3g60390) mRNA, complete cds.
GenBankBT0087130.0BT008713.1 Arabidopsis thaliana At3g60390 gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_191598.10.0homeobox-leucine zipper protein 3
SwissprotP466020.0HAT3_ARATH; Homeobox-leucine zipper protein HAT3
TrEMBLA0A178V9W80.0A0A178V9W8_ARATH; HAT3
STRINGAT3G60390.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM25772772
Representative plantOGRP19616156
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  3. Jiao Y, et al.
    A genome-wide analysis of blue-light regulation of Arabidopsis transcription factor gene expression during seedling development.
    Plant Physiol., 2003. 133(4): p. 1480-93
    [PMID:14605227]
  4. DeCook R,Lall S,Nettleton D,Howell SH
    Genetic regulation of gene expression during shoot development in Arabidopsis.
    Genetics, 2006. 172(2): p. 1155-64
    [PMID:15956669]
  5. Nakayama N, et al.
    Gene trap lines define domains of gene regulation in Arabidopsis petals and stamens.
    Plant Cell, 2005. 17(9): p. 2486-506
    [PMID:16055634]
  6. Henriksson E, et al.
    Homeodomain leucine zipper class I genes in Arabidopsis. Expression patterns and phylogenetic relationships.
    Plant Physiol., 2005. 139(1): p. 509-18
    [PMID:16055682]
  7. Tan QK,Irish VF
    The Arabidopsis zinc finger-homeodomain genes encode proteins with unique biochemical properties that are coordinately expressed during floral development.
    Plant Physiol., 2006. 140(3): p. 1095-108
    [PMID:16428600]
  8. Cao D,Cheng H,Wu W,Soo HM,Peng J
    Gibberellin mobilizes distinct DELLA-dependent transcriptomes to regulate seed germination and floral development in Arabidopsis.
    Plant Physiol., 2006. 142(2): p. 509-25
    [PMID:16920880]
  9. Heyl A, et al.
    The transcriptional repressor ARR1-SRDX suppresses pleiotropic cytokinin activities in Arabidopsis.
    Plant Physiol., 2008. 147(3): p. 1380-95
    [PMID:18502977]
  10. Ciarbelli AR, et al.
    The Arabidopsis homeodomain-leucine zipper II gene family: diversity and redundancy.
    Plant Mol. Biol., 2008. 68(4-5): p. 465-78
    [PMID:18758690]
  11. Sorin C,Salla-Martret M,Bou-Torrent J,Roig-Villanova I,Martínez-García JF
    ATHB4, a regulator of shade avoidance, modulates hormone response in Arabidopsis seedlings.
    Plant J., 2009. 59(2): p. 266-77
    [PMID:19392702]
  12. Arabidopsis Interactome Mapping Consortium
    Evidence for network evolution in an Arabidopsis interactome map.
    Science, 2011. 333(6042): p. 601-7
    [PMID:21798944]
  13. Bou-Torrent J, et al.
    ATHB4 and HAT3, two class II HD-ZIP transcription factors, control leaf development in Arabidopsis.
    Plant Signal Behav, 2012. 7(11): p. 1382-7
    [PMID:22918502]
  14. Turchi L, et al.
    Arabidopsis HD-Zip II transcription factors control apical embryo development and meristem function.
    Development, 2013. 140(10): p. 2118-29
    [PMID:23578926]
  15. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  16. Jin J, et al.
    An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors.
    Mol. Biol. Evol., 2015. 32(7): p. 1767-73
    [PMID:25750178]
  17. Zou LJ, et al.
    Role of Transcription Factor HAT1 in Modulating Arabidopsis thaliana Response to Cucumber mosaic virus.
    Plant Cell Physiol., 2016. 57(9): p. 1879-89
    [PMID:27328697]
  18. Caggiano MP, et al.
    Cell type boundaries organize plant development.
    Elife, 2018.
    [PMID:28895530]
  19. Schena M,Davis RW
    Structure of homeobox-leucine zipper genes suggests a model for the evolution of gene families.
    Proc. Natl. Acad. Sci. U.S.A., 1994. 91(18): p. 8393-7
    [PMID:7915839]