PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT3G60030.1
Common NameSPL12, T2O9.10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family SBP
Protein Properties Length: 927aa    MW: 104142 Da    PI: 6.2023
Description squamosa promoter-binding protein-like 12
Gene Model
Gene Model ID Type Source Coding Sequence
AT3G60030.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP133.38e-42126203178
                  --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
          SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                  +Cqv++C adls++k+yhrrhkvCe+hska+++lv g++qrfCqqCsrfh l+efDe+krsCrrrLa+hn+rrrk+++
  AT3G60030.1 126 CCQVDNCGADLSKVKDYHRRHKVCEIHSKATTALVGGIMQRFCQQCSRFHVLEEFDEGKRSCRRRLAGHNKRRRKANP 203
                  6**************************************************************************875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.109.9E-34122188IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.624124201IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.22E-39125206IPR004333Transcription factor, SBP-box
PfamPF031105.1E-31127200IPR004333Transcription factor, SBP-box
Gene3DG3DSA:1.25.40.202.4E-7713817IPR020683Ankyrin repeat-containing domain
SuperFamilySSF484033.42E-8715816IPR020683Ankyrin repeat-containing domain
CDDcd002041.84E-8718816No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046872Molecular Functionmetal ion binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001017developmental stageM germinated pollen stage
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 927 aa     Download sequence    Send to blast
MEARIEGEVE GHSLEYGFSG KRSVEWDLND WKWNGDLFVA TQLNHGSSNS SSTCSDEGNV  60
EIMERRRIEM EKKKKRRAVT VVAMEEDNLK DDDAHRLTLN LGGNNIEGNG VKKTKLGGGI  120
PSRAICCQVD NCGADLSKVK DYHRRHKVCE IHSKATTALV GGIMQRFCQQ CSRFHVLEEF  180
DEGKRSCRRR LAGHNKRRRK ANPDTIGNGT SMSDDQTSNY MLITLLKILS NIHSNQSDQT  240
GDQDLLSHLL KSLVSQAGEH IGRNLVGLLQ GGGGLQASQN IGNLSALLSL EQAPREDIKH  300
HSVSETPWQE VYANSAQERV APDRSEKQVK VNDFDLNDIY IDSDDTTDIE RSSPPPTNPA  360
TSSLDYHQDS RQSSPPQTSR RNSDSASDQS PSSSSGDAQS RTDRIVFKLF GKEPNDFPVA  420
LRGQILNWLA HTPTDMESYI RPGCIVLTIY LRQDEASWEE LCCDLSFSLR RLLDLSDDPL  480
WTDGWLYLRV QNQLAFAFNG QVVLDTSLPL RSHDYSQIIT VRPLAVTKKA QFTVKGINLR  540
RPGTRLLCTV EGTHLVQEAT QGGMEERDDL KENNEIDFVN FSCEMPIASG RGFMEIEDQG  600
GLSSSFFPFI VSEDEDICSE IRRLESTLEF TGTDSAMQAM DFIHEIGWLL HRSELKSRLA  660
ASDHNPEDLF SLIRFKFLIE FSMDREWCCV MKKLLNILFE EGTVDPSPDA ALSELCLLHR  720
AVRKNSKPMV EMLLRFSPKK KNQTLAGLFR PDAAGPGGLT PLHIAAGKDG SEDVLDALTE  780
DPGMTGIQAW KNSRDNTGFT PEDYARLRGH FSYIHLVQRK LSRKPIAKEH VVVNIPESFN  840
IEHKQEKRSP MDSSSLEITQ INQCKLCDHK RVFVTTHHKS VAYRPAMLSM VAIAAVCVCV  900
ALLFKSCPEV LYVFQPFRWE LLEYGTS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj0_A5e-36124181360squamosa promoter-binding protein-like 12
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
17176KKKKRR
27276KKKRR
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.5020.0bud| flower| inflorescence| leaf| root| seed| silique
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible251450_at0.0
Expression AtlasAT3G60030-
AtGenExpressAT3G60030-
ATTED-IIAT3G60030-
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed during plant development. {ECO:0000269|PubMed:10524240}.
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'. {ECO:0000269|PubMed:16554053}.
Function -- GeneRIF ? help Back to Top
  1. an Arabidopsis SPL12 SBP-domain fragment that lacks a Cys residue involved in the C-terminal zinc-binding pocket was found to retain a folded structure, even though only a single Zn2+ ion binds to the fragment
    [PMID: 16554053]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00060PBM25215497Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT3G60030.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT3G60030
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ1320960.0AJ132096.1 Arabidopsis thaliana mRNA for squamosa promoter binding protein-like 12.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_191562.10.0squamosa promoter-binding-like protein 12
SwissprotQ9S7P50.0SPL12_ARATH; Squamosa promoter-binding-like protein 12
TrEMBLC0SVF50.0C0SVF5_ARATH; Putative uncharacterized protein At3g60030 (Fragment)
STRINGAT3G60030.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP25951432
MalvidsOGEM30302764
Publications ? help Back to Top
  1. Cardon G, et al.
    Molecular characterisation of the Arabidopsis SBP-box genes.
    Gene, 1999. 237(1): p. 91-104
    [PMID:10524240]
  2. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  3. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  4. Yamasaki K, et al.
    A novel zinc-binding motif revealed by solution structures of DNA-binding domains of Arabidopsis SBP-family transcription factors.
    J. Mol. Biol., 2004. 337(1): p. 49-63
    [PMID:15001351]
  5. Yamasaki K, et al.
    An Arabidopsis SBP-domain fragment with a disrupted C-terminal zinc-binding site retains its tertiary structure.
    FEBS Lett., 2006. 580(8): p. 2109-16
    [PMID:16554053]