PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT3G59470.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family FAR1
Protein Properties Length: 251aa    MW: 28864.4 Da    PI: 6.3775
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT3G59470.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR195.18.4e-3085172291
         FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHelap 91 
                  fYn+YA++vGF +r+sk ++s+++g+ + r++vC+keg+r ++k++  k  r+raetr+gCka++ ++ke++gkw++tk+++eHnH+l+p
  AT3G59470.1  85 FYNAYATKVGFVIRVSKLSRSRHDGSPIGRQLVCNKEGYRLPSKRD--KVIRQRAETRVGCKAMILIRKENSGKWVITKFVKEHNHSLMP 172
                  9******************************************999..999************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031011.3E-2785172IPR004330FAR1 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009585Biological Processred, far-red light phototransduction
GO:0010018Biological Processfar-red light signaling pathway
GO:0042753Biological Processpositive regulation of circadian rhythm
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000084anatomyplant sperm cell
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025195anatomypollen tube cell
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 251 aa     Download sequence    Send to blast
MMMGIPVELE VTTVENHNEM GESSGQAMIE QDDDNHNELG ENSGEQDEKV DLDSIPLAVA  60
DMTEAQGDEP YVGQEFESEA AAHGFYNAYA TKVGFVIRVS KLSRSRHDGS PIGRQLVCNK  120
EGYRLPSKRD KVIRQRAETR VGCKAMILIR KENSGKWVIT KFVKEHNHSL MPGRVRRGCI  180
YDQYPNEHDK IQELMQQLAA EKKRAATYKR HLEMLFEQIE QHNESLSKRI QHIVDNVRNL  240
EQRDHQQNHQ V
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.266570.0inflorescence
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible251467_at0.0
Expression AtlasAT3G59470-
AtGenExpressAT3G59470-
ATTED-IIAT3G59470-
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT3G59470.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Interaction ? help Back to Top
Source Intact With
BioGRIDAT1G23420
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT3G59470
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY1430810.0AY143081.1 Arabidopsis thaliana At3g59470/T16L24_20 mRNA, complete cds.
GenBankAY0580890.0AY058089.1 Arabidopsis thaliana AT3g59470/T16L24_20 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001190136.10.0Far-red impaired responsive (FAR1) family protein
RefseqNP_567085.10.0Far-red impaired responsive (FAR1) family protein
TrEMBLQ93Z680.0Q93Z68_ARATH; AT3g59470/T16L24_20
STRINGAT3G59470.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP10299610
MalvidsOGEM73022539
Publications ? help Back to Top
  1. Baxter-Burrell A,Chang R,Springer P,Bailey-Serres J
    Gene and enhancer trap transposable elements reveal oxygen deprivation-regulated genes and their complex patterns of expression in Arabidopsis.
    Ann. Bot., 2003. 91 Spec No: p. 129-41
    [PMID:12509334]
  2. Ascencio-Ib
    Global analysis of Arabidopsis gene expression uncovers a complex array of changes impacting pathogen response and cell cycle during geminivirus infection.
    Plant Physiol., 2008. 148(1): p. 436-54
    [PMID:18650403]
  3. Wang Y, et al.
    Transcriptome analyses show changes in gene expression to accompany pollen germination and tube growth in Arabidopsis.
    Plant Physiol., 2008. 148(3): p. 1201-11
    [PMID:18775970]
  4. Arabidopsis Interactome Mapping Consortium
    Evidence for network evolution in an Arabidopsis interactome map.
    Science, 2011. 333(6042): p. 601-7
    [PMID:21798944]