PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT3G58120.1
Common NameATBZIP61, BZIP61, F9D24.30
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family bZIP
Protein Properties Length: 329aa    MW: 36805.2 Da    PI: 6.8036
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT3G58120.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_133.21.1e-10204247548
                  CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkke 48 
                  kr +r   NR +A+rsR RK+++i eLe+ v +L++e + L  +
  AT3G58120.1 204 KRVKRILANRQSAQRSRVRKLQYISELERSVTSLQTEVSVLSPR 247
                  899********************************998777655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.1E-13200264IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.588202254IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.49E-11204258No hitNo description
Gene3DG3DSA:1.20.5.1703.0E-13204255No hitNo description
PfamPF001703.0E-9204248IPR004827Basic-leucine zipper domain
CDDcd147034.24E-24205255No hitNo description
PROSITE patternPS000360207222IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0000977Molecular FunctionRNA polymerase II regulatory region sequence-specific DNA binding
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005515Molecular Functionprotein binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025195anatomypollen tube cell
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 329 aa     Download sequence    Send to blast
MAQLPPKIPT MTTPNWPDFS SQKLPSIAAT AAAAATAGPQ QQNPSWMDEF LDFSATRRGT  60
HRRSISDSIA FLEPPSSGVG NHHFDRFDDE QFMSMFNDDV HNNNHNHHHH HSINGNVGPT  120
RSSSNTSTPS DHNSLSDDDN NKEAPPSDHD HHMDNNVANQ NNAAGNNYNE SDEVQSQCKT  180
EPQDGPSANQ NSGGSSGNRI HDPKRVKRIL ANRQSAQRSR VRKLQYISEL ERSVTSLQTE  240
VSVLSPRVAF LDHQRLLLNV DNSAIKQRIA ALAQDKIFKD AHQEALKREI ERLRQVYHQQ  300
SLKKMENNVS DQSPADIKPS VEKEQLLNV
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.236000.0floral meristem| seed| silique
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO425660240.0
Genevisible251575_at0.0
Expression AtlasAT3G58120-
AtGenExpressAT3G58120-
ATTED-IIAT3G58120-
Functional Description ? help Back to Top
Source Description
TAIREncodes a member of the BZIP family of transcription factors. Forms heterodimers with the related protein AtbZIP34. Binds to G-boxes in vitro and is localized to the nucleus in onion epidermal cells.
UniProtTranscriptional activator. {ECO:0000269|PubMed:17719007}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT3G58120.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Interaction ? help Back to Top
Source Intact With
BioGRIDAT3G58120, AT5G38800, AT1G43700
IntActSearch Q9M2K4
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT3G58120
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0087280.0BT008728.1 Arabidopsis thaliana At3g58120 gene, complete cds.
GenBankAY0930530.0AY093053.1 Arabidopsis thaliana pelota-like protein (At3g58120) mRNA, complete cds.
GenBankAY0873560.0AY087356.1 Arabidopsis thaliana clone 34553 mRNA, complete sequence.
GenBankAF4013000.0AF401300.1 Arabidopsis thaliana transcription factor bZIP61 (BZIP61) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_191371.10.0transcription factor BZIP61
SwissprotQ9M2K40.0BZP61_ARATH; Basic leucine zipper 61
TrEMBLD7LW030.0D7LW03_ARALL; BZIP transcription factor family protein
STRINGAT3G58120.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP12617181
MalvidsOGEM17532777
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Jakoby M, et al.
    bZIP transcription factors in Arabidopsis.
    Trends Plant Sci., 2002. 7(3): p. 106-11
    [PMID:11906833]
  3. Dal Bosco C, et al.
    Inactivation of the chloroplast ATP synthase gamma subunit results in high non-photochemical fluorescence quenching and altered nuclear gene expression in Arabidopsis thaliana.
    J. Biol. Chem., 2004. 279(2): p. 1060-9
    [PMID:14576160]
  4. Satoh R,Fujita Y,Nakashima K,Shinozaki K,Yamaguchi-Shinozaki K
    A novel subgroup of bZIP proteins functions as transcriptional activators in hypoosmolarity-responsive expression of the ProDH gene in Arabidopsis.
    Plant Cell Physiol., 2004. 45(3): p. 309-17
    [PMID:15047879]
  5. Hilson P, et al.
    Versatile gene-specific sequence tags for Arabidopsis functional genomics: transcript profiling and reverse genetics applications.
    Genome Res., 2004. 14(10B): p. 2176-89
    [PMID:15489341]
  6. Coupe SA, et al.
    Systemic signalling of environmental cues in Arabidopsis leaves.
    J. Exp. Bot., 2006. 57(2): p. 329-41
    [PMID:16330523]
  7. Oono Y, et al.
    Monitoring expression profiles of Arabidopsis genes during cold acclimation and deacclimation using DNA microarrays.
    Funct. Integr. Genomics, 2006. 6(3): p. 212-34
    [PMID:16463051]
  8. Kim J,Shiu SH,Thoma S,Li WH,Patterson SE
    Patterns of expansion and expression divergence in the plant polygalacturonase gene family.
    Genome Biol., 2006. 7(9): p. R87
    [PMID:17010199]
  9. Bezhani S, et al.
    Unique, shared, and redundant roles for the Arabidopsis SWI/SNF chromatin remodeling ATPases BRAHMA and SPLAYED.
    Plant Cell, 2007. 19(2): p. 403-16
    [PMID:17293567]
  10. Popescu SC, et al.
    Differential binding of calmodulin-related proteins to their targets revealed through high-density Arabidopsis protein microarrays.
    Proc. Natl. Acad. Sci. U.S.A., 2007. 104(11): p. 4730-5
    [PMID:17360592]
  11. Kleine T,Kindgren P,Benedict C,Hendrickson L,Strand A
    Genome-wide gene expression analysis reveals a critical role for CRYPTOCHROME1 in the response of Arabidopsis to high irradiance.
    Plant Physiol., 2007. 144(3): p. 1391-406
    [PMID:17478635]
  12. Shen H,Cao K,Wang X
    A conserved proline residue in the leucine zipper region of AtbZIP34 and AtbZIP61 in Arabidopsis thaliana interferes with the formation of homodimer.
    Biochem. Biophys. Res. Commun., 2007. 362(2): p. 425-30
    [PMID:17719007]
  13. Huang D,Wu W,Abrams SR,Cutler AJ
    The relationship of drought-related gene expression in Arabidopsis thaliana to hormonal and environmental factors.
    J. Exp. Bot., 2008. 59(11): p. 2991-3007
    [PMID:18552355]
  14. Wang Y, et al.
    Transcriptome analyses show changes in gene expression to accompany pollen germination and tube growth in Arabidopsis.
    Plant Physiol., 2008. 148(3): p. 1201-11
    [PMID:18775970]