PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT3G57920.1
Common NameSPL15, T10K17.130
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family SBP
Protein Properties Length: 354aa    MW: 39672.4 Da    PI: 8.994
Description squamosa promoter binding protein-like 15
Gene Model
Gene Model ID Type Source Coding Sequence
AT3G57920.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP127.74.3e-4058135178
                  --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
          SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                  +CqvegC++dls++k y++rhkvC +hsk+++v+vsgl+qrfCqqCsrfh+lsefD ekrsCrrrLa hnerrrk+q+
  AT3G57920.1  58 RCQVEGCRMDLSNVKAYYSRHKVCCIHSKSSKVIVSGLHQRFCQQCSRFHQLSEFDLEKRSCRRRLACHNERRRKPQP 135
                  6**************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.108.7E-3152120IPR004333Transcription factor, SBP-box
PROSITE profilePS5114130.98356133IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.88E-3757137IPR004333Transcription factor, SBP-box
PfamPF031101.0E-2859132IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008361Biological Processregulation of cell size
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0042127Biological Processregulation of cell proliferation
GO:0048653Biological Processanther development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046872Molecular Functionmetal ion binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009052anatomyflower pedicel
PO:0025022anatomycollective leaf structure
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 354 aa     Download sequence    Send to blast
MELLMCSGQA ESGGSSSTES SSLSGGLRFG QKIYFEDGSG SRSKNRVNTV RKSSTTARCQ  60
VEGCRMDLSN VKAYYSRHKV CCIHSKSSKV IVSGLHQRFC QQCSRFHQLS EFDLEKRSCR  120
RRLACHNERR RKPQPTTALF TSHYSRIAPS LYGNPNAAMI KSVLGDPTAW STARSVMQRP  180
GPWQINPVRE THPHMNVLSH GSSSFTTCPE MINNNSTDSS CALSLLSNSY PIHQQQLQTP  240
TNTWRPSSGF DSMISFSDKV TMAQPPPIST HQPPISTHQQ YLSQTWEVIA GEKSNSHYMS  300
PVSQISEPAD FQISNGTTMG GFELYLHQQV LKQYMEPENT RAYDSSPQHF NWSL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A4e-2853132584squamosa promoter binding protein-like 4
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.347840.0floral meristem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1453396220.0
Genevisible251560_at0.0
Expression AtlasAT3G57920-
AtGenExpressAT3G57920-
ATTED-IIAT3G57920-
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Weak increase of expression during floral induction. {ECO:0000269|PubMed:14573523}.
Functional Description ? help Back to Top
Source Description
TAIREncodes a putative transcriptional regulator that is involved in the vegetative to reproductive phase transition. Expression is regulated by MIR156b.
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'. {ECO:0000250}.
Function -- GeneRIF ? help Back to Top
  1. SPL15 has a role in shoot maturation.
    [PMID: 18278578]
  2. Enhanced miR156b expression in sk156 leads to the mutant phenotype including carotenoid levels in the seed through suppression of SPL15 and other SPL target genes.
    [PMID: 22989211]
  3. SPL15 and the MADS-box protein SOC1 cooperate to promote transcription of their target genes.
    [PMID: 27134142]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00412DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT3G57920.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Negatively regulated by microRNAs miR157. {ECO:0000305|PubMed:12202040}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT3G57920
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0863840.0AY086384.1 Arabidopsis thaliana clone 247919 mRNA, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_191351.10.0squamosa promoter binding protein-like 15
SwissprotQ9M2Q60.0SPL15_ARATH; Squamosa promoter-binding-like protein 15
TrEMBLA0A178V8500.0A0A178V850_ARATH; SPL15
STRINGAT3G57920.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM21442775
Representative plantOGRP9717230
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Rhoades MW, et al.
    Prediction of plant microRNA targets.
    Cell, 2002. 110(4): p. 513-20
    [PMID:12202040]
  3. Schmid M, et al.
    Dissection of floral induction pathways using global expression analysis.
    Development, 2003. 130(24): p. 6001-12
    [PMID:14573523]
  4. Scheible WR, et al.
    Genome-wide reprogramming of primary and secondary metabolism, protein synthesis, cellular growth processes, and the regulatory infrastructure of Arabidopsis in response to nitrogen.
    Plant Physiol., 2004. 136(1): p. 2483-99
    [PMID:15375205]
  5. Birkenbihl RP,Jach G,Saedler H,Huijser P
    Functional dissection of the plant-specific SBP-domain: overlap of the DNA-binding and nuclear localization domains.
    J. Mol. Biol., 2005. 352(3): p. 585-96
    [PMID:16095614]
  6. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  7. Schwarz S,Grande AV,Bujdoso N,Saedler H,Huijser P
    The microRNA regulated SBP-box genes SPL9 and SPL15 control shoot maturation in Arabidopsis.
    Plant Mol. Biol., 2008. 67(1-2): p. 183-95
    [PMID:18278578]
  8. Wang JW,Schwab R,Czech B,Mica E,Weigel D
    Dual effects of miR156-targeted SPL genes and CYP78A5/KLUH on plastochron length and organ size in Arabidopsis thaliana.
    Plant Cell, 2008. 20(5): p. 1231-43
    [PMID:18492871]
  9. Usami T,Horiguchi G,Yano S,Tsukaya H
    The more and smaller cells mutants of Arabidopsis thaliana identify novel roles for SQUAMOSA PROMOTER BINDING PROTEIN-LIKE genes in the control of heteroblasty.
    Development, 2009. 136(6): p. 955-64
    [PMID:19211679]
  10. Xing S,Salinas M,H
    miR156-targeted and nontargeted SBP-box transcription factors act in concert to secure male fertility in Arabidopsis.
    Plant Cell, 2010. 22(12): p. 3935-50
    [PMID:21177480]
  11. Deng W, et al.
    FLOWERING LOCUS C (FLC) regulates development pathways throughout the life cycle of Arabidopsis.
    Proc. Natl. Acad. Sci. U.S.A., 2011. 108(16): p. 6680-5
    [PMID:21464308]
  12. Wei S, et al.
    Arabidopsis mutant sk156 reveals complex regulation of SPL15 in a miR156-controlled gene network.
    BMC Plant Biol., 2012. 12: p. 169
    [PMID:22989211]
  13. Morea EG, et al.
    Functional and evolutionary analyses of the miR156 and miR529 families in land plants.
    BMC Plant Biol., 2016. 16: p. 40
    [PMID:26841873]
  14. Hyun Y, et al.
    Multi-layered Regulation of SPL15 and Cooperation with SOC1 Integrate Endogenous Flowering Pathways at the Arabidopsis Shoot Meristem.
    Dev. Cell, 2016. 37(3): p. 254-66
    [PMID:27134142]
  15. Xu M, et al.
    Developmental Functions of miR156-Regulated SQUAMOSA PROMOTER BINDING PROTEIN-LIKE (SPL) Genes in Arabidopsis thaliana.
    PLoS Genet., 2016. 12(8): p. e1006263
    [PMID:27541584]