PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT3G57230.1
Common NameAGL16, F28O9.80
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MIKC_MADS
Protein Properties Length: 240aa    MW: 27428.1 Da    PI: 7.4351
Description AGAMOUS-like 16
Gene Model
Gene Model ID Type Source Coding Sequence
AT3G57230.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF87.67.1e-28959151
                 S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
       SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                 kri+n++ rqvtfskRrng+lKKA+EL +LCdaev viifsstg+ly++ss
  AT3G57230.1  9 KRINNSTSRQVTFSKRRNGLLKKAKELAILCDAEVGVIIFSSTGRLYDFSS 59
                 79***********************************************96 PP

2K-box80.44.4e-2776170498
        K-box   4 ssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 
                  +s+++  +++ + +q+e+a Lk++++nLq+++R+++Ge+L+ Ls++ Lq+Le+qLe sl+ +R kK+++l+e+i+ l +  + +++en +L+kk+
  AT3G57230.1  76 TSSENDPASEIQFWQKEAAILKRQLHNLQENHRQMMGEELSGLSVEALQNLENQLELSLRGVRMKKDQMLIEEIQVLNREGNLVHQENLDLHKKV 170
                  45555678899**********************************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004322.2E-39160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006631.791161IPR002100Transcription factor, MADS-box
CDDcd002656.22E-44278No hitNo description
SuperFamilySSF554552.09E-32290IPR002100Transcription factor, MADS-box
PRINTSPR004044.1E-28323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003192.9E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004044.1E-282338IPR002100Transcription factor, MADS-box
PRINTSPR004044.1E-283859IPR002100Transcription factor, MADS-box
PfamPF014869.2E-2583170IPR002487Transcription factor, K-box
PROSITE profilePS5129715.60986176IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010440Biological Processstomatal lineage progression
GO:0048574Biological Processlong-day photoperiodism, flowering
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008134Molecular Functiontranscription factor binding
GO:0042803Molecular Functionprotein homodimerization activity
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000084anatomyplant sperm cell
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0006504anatomyleaf trichome
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025195anatomypollen tube cell
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 240 aa     Download sequence    Send to blast
MGRGKIAIKR INNSTSRQVT FSKRRNGLLK KAKELAILCD AEVGVIIFSS TGRLYDFSSS  60
SMKSVIERYS DAKGETSSEN DPASEIQFWQ KEAAILKRQL HNLQENHRQM MGEELSGLSV  120
EALQNLENQL ELSLRGVRMK KDQMLIEEIQ VLNREGNLVH QENLDLHKKV NLMHQQNMEL  180
HEKVSEVEGV KIANKNSLLT NGLDMRDTSN EHVHLQLSQP QHDHETHSKA IQLNYFSFIA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5f28_A4e-20171171MEF2C
5f28_B4e-20171171MEF2C
5f28_C4e-20171171MEF2C
5f28_D4e-20171171MEF2C
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.211020.0root| seed
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO2402556580.0
Genevisible251672_at0.0
Expression AtlasAT3G57230-
AtGenExpressAT3G57230-
ATTED-IIAT3G57230-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed at high levels in leaves, moderate levels in roots, seedlings and stems, and at low levels in flowers, pollen and siliques. Accumulates in leaf guard cells and trichomes. Also present in epidermal cells of roots (PubMed:11115127, PubMed:12837945, PubMed:12949148). Expressed in mature guard cells (PubMed:17704216). {ECO:0000269|PubMed:11115127, ECO:0000269|PubMed:12837945, ECO:0000269|PubMed:12949148, ECO:0000269|PubMed:17704216}.
Functional Description ? help Back to Top
Source Description
TAIRMADS-box transcription factor. Expressed in leaf, root and stem, with higher RNA accumulation in guard cells and trichomes.
UniProtProbable transcription factor involved in the regulation of flowering time in long-day photoperiod. Participates in the repression of FT expression and floral transition, by interacting closely with the FLC-SVP pathways (PubMed:24876250). Functions in the satellite meristemoid lineage of stomatal development (PubMed:17704216). {ECO:0000269|PubMed:17704216, ECO:0000269|PubMed:24876250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00410DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT3G57230.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed by the micro RNA miR824. {ECO:0000269|PubMed:18579782}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Interaction ? help Back to Top
Source Intact With
BioGRIDAT3G57230, AT3G58780, AT4G09960, AT4G11880, AT4G18960, AT4G24540, AT4G37940, AT5G10140, AT5G13790, AT5G15800, AT5G27070, AT5G62165, AT1G24260, AT1G31140, AT1G69120, AT1G71692
IntActSearch A2RVQ5
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT3G57230
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0300460.0BT030046.1 Arabidopsis thaliana At3g57230 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001326287.11e-176AGAMOUS-like 16
RefseqNP_191282.21e-176AGAMOUS-like 16
SwissprotA2RVQ51e-177AGL16_ARATH; Agamous-like MADS-box protein AGL16
TrEMBLA0A178VIZ51e-175A0A178VIZ5_ARATH; AGL16
STRINGAT3G57230.11e-175(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM53024105
Representative plantOGRP1617761
Publications ? help Back to Top
  1. Alvarez-Buylla ER, et al.
    MADS-box gene evolution beyond flowers: expression in pollen, endosperm, guard cells, roots and trichomes.
    Plant J., 2000. 24(4): p. 457-66
    [PMID:11115127]
  2. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  3. Parenicová L, et al.
    Molecular and phylogenetic analyses of the complete MADS-box transcription factor family in Arabidopsis: new openings to the MADS world.
    Plant Cell, 2003. 15(7): p. 1538-51
    [PMID:12837945]
  4. Kofuji R, et al.
    Evolution and divergence of the MADS-box gene family based on genome-wide expression analyses.
    Mol. Biol. Evol., 2003. 20(12): p. 1963-77
    [PMID:12949148]
  5. Gong W, et al.
    Genome-wide ORFeome cloning and analysis of Arabidopsis transcription factor genes.
    Plant Physiol., 2004. 135(2): p. 773-82
    [PMID:15208423]
  6. He Y,Doyle MR,Amasino RM
    PAF1-complex-mediated histone methylation of FLOWERING LOCUS C chromatin is required for the vernalization-responsive, winter-annual habit in Arabidopsis.
    Genes Dev., 2004. 18(22): p. 2774-84
    [PMID:15520273]
  7. de Folter S, et al.
    Comprehensive interaction map of the Arabidopsis MADS Box transcription factors.
    Plant Cell, 2005. 17(5): p. 1424-33
    [PMID:15805477]
  8. Pina C,Pinto F,Feij
    Gene family analysis of the Arabidopsis pollen transcriptome reveals biological implications for cell growth, division control, and gene expression regulation.
    Plant Physiol., 2005. 138(2): p. 744-56
    [PMID:15908605]
  9. Rajagopalan R,Vaucheret H,Trejo J,Bartel DP
    A diverse and evolutionarily fluid set of microRNAs in Arabidopsis thaliana.
    Genes Dev., 2006. 20(24): p. 3407-25
    [PMID:17182867]
  10. Kutter C,Schöb H,Stadler M,Meins F,Si-Ammour A
    MicroRNA-mediated regulation of stomatal development in Arabidopsis.
    Plant Cell, 2007. 19(8): p. 2417-29
    [PMID:17704216]
  11. de Meaux J,Hu JY,Tartler U,Goebel U
    Structurally different alleles of the ath-MIR824 microRNA precursor are maintained at high frequency in Arabidopsis thaliana.
    Proc. Natl. Acad. Sci. U.S.A., 2008. 105(26): p. 8994-9
    [PMID:18579782]
  12. Wang Y, et al.
    Transcriptome analyses show changes in gene expression to accompany pollen germination and tube growth in Arabidopsis.
    Plant Physiol., 2008. 148(3): p. 1201-11
    [PMID:18775970]
  13. Jakoby MJ, et al.
    Transcriptional profiling of mature Arabidopsis trichomes reveals that NOECK encodes the MIXTA-like transcriptional regulator MYB106.
    Plant Physiol., 2008. 148(3): p. 1583-602
    [PMID:18805951]
  14. Yang K,Jiang M,Le J
    A new loss-of-function allele 28y reveals a role of ARGONAUTE1 in limiting asymmetric division of stomatal lineage ground cell.
    J Integr Plant Biol, 2014. 56(6): p. 539-49
    [PMID:24386951]
  15. Hu JY, et al.
    miR824-Regulated AGAMOUS-LIKE16 Contributes to Flowering Time Repression in Arabidopsis.
    Plant Cell, 2014. 26(5): p. 2024-2037
    [PMID:24876250]