PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT3G56850.1
Common NameAREB3, BZIP66, DPBF3, T8M16_180
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family bZIP
Protein Properties Length: 297aa    MW: 32418.5 Da    PI: 9.9514
Description ABA-responsive element binding protein 3
Gene Model
Gene Model ID Type Source Coding Sequence
AT3G56850.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_150.73.8e-16227270548
                  CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkke 48 
                  +r++r++kNRe+A rsR+RK+a++ eLe kv  Le+eN++L+k+
  AT3G56850.1 227 RRQKRMIKNRESAARSRARKQAYTHELEIKVSRLEEENERLRKQ 270
                  79****************************************75 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1704.7E-15220270No hitNo description
SMARTSM003384.6E-13223295IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.45225270IPR004827Basic-leucine zipper domain
CDDcd147077.49E-23227272No hitNo description
PfamPF001704.6E-13227270IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.69E-10227272No hitNo description
PROSITE patternPS000360230245IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009737Biological Processresponse to abscisic acid
GO:0009738Biological Processabscisic acid-activated signaling pathway
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000005anatomycultured plant cell
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001017developmental stageM germinated pollen stage
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 297 aa     Download sequence    Send to blast
MDSQRGIVEQ AKSQSLNRQS SLYSLTLDEV QNHLGSSGKA LGSMNLDELL KSVCSVEANQ  60
PSSMAVNGGA AAQEGLSRQG SLTLPRDLSK KTVDEVWKDI QQNKNGGSAH ERRDKQPTLG  120
EMTLEDLLLK AGVVTETIPG SNHDGPVGGG SAGSGAGLGQ NITQVGPWIQ YHQLPSMPQP  180
QAFMPYPVSD MQAMVSQSSL MGGLSDTQTP GRKRVASGEV VEKTVERRQK RMIKNRESAA  240
RSRARKQAYT HELEIKVSRL EEENERLRKQ KEVEKILPSV PPPDPKRQLR RTSSAPF
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.53570.0flower| seed| silique| vegetative tissue
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO306945210.0
Genevisible246314_at0.0
Expression AtlasAT3G56850-
AtGenExpressAT3G56850-
ATTED-IIAT3G56850-
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed in embryo during the latest stages of seed maturation. {ECO:0000269|PubMed:15642716}.
UniprotTISSUE SPECIFICITY: Predominantly expressed in seeds. {ECO:0000269|PubMed:12376636}.
Functional Description ? help Back to Top
Source Description
TAIREncodes an ABA-responsive element binding protein with a bZIP domain. Located in the nucleus and expressed in the embryo during seed maturation.
UniProtBinds to the embryo specification element and the ABA-responsive element (ABRE) of the Dc3 gene promoter. Could participate in abscisic acid-regulated gene expression during seed development.
Function -- GeneRIF ? help Back to Top
  1. Characterization of AREB3 protein and two other genes of the ABI family during seed maturation.
    [PMID: 15642716]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00409DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT3G56850.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Interaction ? help Back to Top
Source Intact With
IntActSearch Q9LES3
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT3G56850
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0816700.0AY081670.1 Arabidopsis thaliana promoter-binding factor-like protein (At3g56850) mRNA, complete cds.
GenBankAY0624480.0AY062448.1 Arabidopsis thaliana promoter-binding factor-like protein (At3g56850; T8M16_180) mRNA, complete cds.
GenBankAB0171620.0AB017162.1 Arabidopsis thaliana mRNA for ABA-responsive element binding protein 3 (AREB3), complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_191244.10.0ABA-responsive element binding protein 3
SwissprotQ9LES30.0AI5L2_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 2
TrEMBLV4NE970.0V4NE97_EUTSA; Uncharacterized protein
STRINGAT3G56850.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5401580
MalvidsOGEM18842883
Publications ? help Back to Top
  1. Choi H,Hong J,Ha J,Kang J,Kim SY
    ABFs, a family of ABA-responsive element binding factors.
    J. Biol. Chem., 2000. 275(3): p. 1723-30
    [PMID:10636868]
  2. Finkelstein RR,Lynch TJ
    The Arabidopsis abscisic acid response gene ABI5 encodes a basic leucine zipper transcription factor.
    Plant Cell, 2000. 12(4): p. 599-609
    [PMID:10760247]
  3. Uno Y, et al.
    Arabidopsis basic leucine zipper transcription factors involved in an abscisic acid-dependent signal transduction pathway under drought and high-salinity conditions.
    Proc. Natl. Acad. Sci. U.S.A., 2000. 97(21): p. 11632-7
    [PMID:11005831]
  4. Riechmann JL,Ratcliffe OJ
    A genomic perspective on plant transcription factors.
    Curr. Opin. Plant Biol., 2000. 3(5): p. 423-34
    [PMID:11019812]
  5. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  6. Jakoby M, et al.
    bZIP transcription factors in Arabidopsis.
    Trends Plant Sci., 2002. 7(3): p. 106-11
    [PMID:11906833]
  7. Brocard IM,Lynch TJ,Finkelstein RR
    Regulation and role of the Arabidopsis abscisic acid-insensitive 5 gene in abscisic acid, sugar, and stress response.
    Plant Physiol., 2002. 129(4): p. 1533-43
    [PMID:12177466]
  8. Kim SY,Ma J,Perret P,Li Z,Thomas TL
    Arabidopsis ABI5 subfamily members have distinct DNA-binding and transcriptional activities.
    Plant Physiol., 2002. 130(2): p. 688-97
    [PMID:12376636]
  9. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  10. Deppmann CD, et al.
    Dimerization specificity of all 67 B-ZIP motifs in Arabidopsis thaliana: a comparison to Homo sapiens B-ZIP motifs.
    Nucleic Acids Res., 2004. 32(11): p. 3435-45
    [PMID:15226410]
  11. Bensmihen S,Giraudat J,Parcy F
    Characterization of three homologous basic leucine zipper transcription factors (bZIP) of the ABI5 family during Arabidopsis thaliana embryo maturation.
    J. Exp. Bot., 2005. 56(412): p. 597-603
    [PMID:15642716]
  12. Fujita Y, et al.
    AREB1 Is a transcription activator of novel ABRE-dependent ABA signaling that enhances drought stress tolerance in Arabidopsis.
    Plant Cell, 2005. 17(12): p. 3470-88
    [PMID:16284313]
  13. Deppmann CD,Alvania RS,Taparowsky EJ
    Cross-species annotation of basic leucine zipper factor interactions: Insight into the evolution of closed interaction networks.
    Mol. Biol. Evol., 2006. 23(8): p. 1480-92
    [PMID:16731568]
  14. Jung C, et al.
    Overexpression of AtMYB44 enhances stomatal closure to confer abiotic stress tolerance in transgenic Arabidopsis.
    Plant Physiol., 2008. 146(2): p. 623-35
    [PMID:18162593]
  15. Garcia ME,Lynch T,Peeters J,Snowden C,Finkelstein R
    A small plant-specific protein family of ABI five binding proteins (AFPs) regulates stress response in germinating Arabidopsis seeds and seedlings.
    Plant Mol. Biol., 2008. 67(6): p. 643-58
    [PMID:18484180]
  16. Reiland S, et al.
    Large-scale Arabidopsis phosphoproteome profiling reveals novel chloroplast kinase substrates and phosphorylation networks.
    Plant Physiol., 2009. 150(2): p. 889-903
    [PMID:19376835]
  17. Hoth S,Niedermeier M,Feuerstein A,Hornig J,Sauer N
    An ABA-responsive element in the AtSUC1 promoter is involved in the regulation of AtSUC1 expression.
    Planta, 2010. 232(4): p. 911-23
    [PMID:20635094]
  18. Kline KG,Barrett-Wilt GA,Sussman MR
    In planta changes in protein phosphorylation induced by the plant hormone abscisic acid.
    Proc. Natl. Acad. Sci. U.S.A., 2010. 107(36): p. 15986-91
    [PMID:20733066]
  19. Arabidopsis Interactome Mapping Consortium
    Evidence for network evolution in an Arabidopsis interactome map.
    Science, 2011. 333(6042): p. 601-7
    [PMID:21798944]
  20. Marondedze C, et al.
    Structural and functional characteristics of cGMP-dependent methionine oxidation in Arabidopsis thaliana proteins.
    Cell Commun. Signal, 2013. 11(1): p. 1
    [PMID:23289948]
  21. Wang P, et al.
    Quantitative phosphoproteomics identifies SnRK2 protein kinase substrates and reveals the effectors of abscisic acid action.
    Proc. Natl. Acad. Sci. U.S.A., 2013. 110(27): p. 11205-10
    [PMID:23776212]