PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT3G56660.1
Common NameBZIP49, T5P19.310
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family bZIP
Protein Properties Length: 620aa    MW: 68184.2 Da    PI: 5.8997
Description basic region/leucine zipper motif protein 49
Gene Model
Gene Model ID Type Source Coding Sequence
AT3G56660.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_138.13.4e-12172219350
                  XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkele 50 
                  e k+  r+ +NRe+A  sRqRKk ++eeLe+kvk++ +  ++L ++++
  AT3G56660.1 172 EKKKNVRLVRNRESAHLSRQRKKHYVEELEDKVKNMHSTISELSSKMS 219
                  6799********************************999999998876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003384.0E-11168234IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.45172235IPR004827Basic-leucine zipper domain
PfamPF001706.1E-10172231IPR004827Basic-leucine zipper domain
SuperFamilySSF579598.44E-12174232No hitNo description
Gene3DG3DSA:1.20.5.1701.3E-14174232No hitNo description
CDDcd147041.83E-19178225No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005789Cellular Componentendoplasmic reticulum membrane
GO:0016021Cellular Componentintegral component of membrane
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 620 aa     Download sequence    Send to blast
MAEPVLEDTY LTFSSDFDYI AIAPSPFDNF CNSNSDQVRN SISDLRFLID DDDSFDDLYF  60
PSENESFCIP PDATKREMSG DFTPASGISG DCVNEDTEKN TNGVLISTSS CYNRESPTDS  120
DFSGTSQSLS FSGQDSAKRK TEIEEDSSDE SRRLGKDGFA SVIKVGGEED DEKKKNVRLV  180
RNRESAHLSR QRKKHYVEEL EDKVKNMHST ISELSSKMSY FVAENVTLRQ QMGTRFSSGP  240
PMVPIVYPWM QYPAYMVKPQ GSQVALLPIP RLKPKHSVAK VKKFKKVASF SVFGFLFCMF  300
LFGALVNISY GEYKSNYVTD GVYDQSRGRV LVVDSSRVHC GGDSDQGVGR NVSETENLGP  360
PRNSSEPLVA SLFVPRNEKL VKIDGNLIIH SVLASEKARD SETKNEEGKS VLATTTKTLS  420
PALPLPDSTS PRTRDVSKHL YSETGKGLSS SGSDDASNDQ LKSTIANGKM QQWFREGVAG  480
PMFSSGMCTE VFQFDVSSNS GAIIPASPHT QQCKNTSDTQ KGKKNRRILS GGLPVSDFNL  540
TKEDHNSSSK DKFRETKPGP SMVVSVLVDP REGGNGDIDG MMGGTKPQSR VFIVVLVDGV  600
KYITYSCVLP RPDVPHLMTS
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO184105480.0
Genevisible251702_at0.0
Expression AtlasAT3G56660-
AtGenExpressAT3G56660-
ATTED-IIAT3G56660-
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator involved in stress responses. {ECO:0000250|UniProtKB:O22208}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT3G56660.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Interaction ? help Back to Top
Source Intact With
BioGRIDAT3G56660
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT3G56660
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0026860.0CP002686.1 Arabidopsis thaliana chromosome 3, complete sequence.
GenBankAL3909210.0AL390921.1 Arabidopsis thaliana DNA chromosome 3, BAC clone T8M16.
GenBankAL1639720.0AL163972.1 Arabidopsis thaliana DNA chromosome 3, BAC clone T5P19.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_191225.10.0basic region/leucine zipper motif protein 49
SwissprotQ9LXX40.0BZP49_ARATH; bZIP transcription factor 49
TrEMBLD7LVI40.0D7LVI4_ARALL; Putative uncharacterized protein
STRINGAT3G56660.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP21711628
MalvidsOGEM16991911
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Jakoby M, et al.
    bZIP transcription factors in Arabidopsis.
    Trends Plant Sci., 2002. 7(3): p. 106-11
    [PMID:11906833]
  3. Satoh R,Fujita Y,Nakashima K,Shinozaki K,Yamaguchi-Shinozaki K
    A novel subgroup of bZIP proteins functions as transcriptional activators in hypoosmolarity-responsive expression of the ProDH gene in Arabidopsis.
    Plant Cell Physiol., 2004. 45(3): p. 309-17
    [PMID:15047879]
  4. Deppmann CD, et al.
    Dimerization specificity of all 67 B-ZIP motifs in Arabidopsis thaliana: a comparison to Homo sapiens B-ZIP motifs.
    Nucleic Acids Res., 2004. 32(11): p. 3435-45
    [PMID:15226410]
  5. Deppmann CD,Alvania RS,Taparowsky EJ
    Cross-species annotation of basic leucine zipper factor interactions: Insight into the evolution of closed interaction networks.
    Mol. Biol. Evol., 2006. 23(8): p. 1480-92
    [PMID:16731568]
  6. Liu JX,Srivastava R,Che P,Howell SH
    Salt stress responses in Arabidopsis utilize a signal transduction pathway related to endoplasmic reticulum stress signaling.
    Plant J., 2007. 51(5): p. 897-909
    [PMID:17662035]
  7. Liu JX,Srivastava R,Che P,Howell SH
    An endoplasmic reticulum stress response in Arabidopsis is mediated by proteolytic processing and nuclear relocation of a membrane-associated transcription factor, bZIP28.
    Plant Cell, 2007. 19(12): p. 4111-9
    [PMID:18156219]
  8. Tajima H,Iwata Y,Iwano M,Takayama S,Koizumi N
    Identification of an Arabidopsis transmembrane bZIP transcription factor involved in the endoplasmic reticulum stress response.
    Biochem. Biophys. Res. Commun., 2008. 374(2): p. 242-7
    [PMID:18634751]
  9. Liu JX,Howell SH
    bZIP28 and NF-Y transcription factors are activated by ER stress and assemble into a transcriptional complex to regulate stress response genes in Arabidopsis.
    Plant Cell, 2010. 22(3): p. 782-96
    [PMID:20207753]