PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT3G56560.1
Common Nameanac065, NAC065, T5P19_210
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family NAC
Protein Properties Length: 228aa    MW: 25921.4 Da    PI: 9.627
Description NAC domain containing protein 65
Gene Model
Gene Model ID Type Source Coding Sequence
AT3G56560.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM40.11.1e-12115165149
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleev.ikevdiykvePwdLp.k 49 
                  lppGf+F P+d+e++++yLk+  +g+++ l +v i++v+iy+++P++L  +
  AT3G56560.1 115 LPPGFKFMPNDKEVINCYLKPYSDGNTNVLLNVpIHRVNIYESNPQTLSgR 165
                  79*************************9999999**************833 PP

2NAM28.44.6e-0918721996128
          NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrl 128
                  ++ +vg k+ L++y g+ ++g+ktdW+m+ey+l
  AT3G56560.1 187 GDGVVGNKRPLAYYVGKPSEGVKTDWLMQEYSL 219
                  6778***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019417.32E-26104225IPR003441NAC domain
PROSITE profilePS5100515.815115228IPR003441NAC domain
PfamPF023652.2E-10116219IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007275Biological Processmulticellular organism development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 228 aa     Download sequence    Send to blast
MFDFKIFTFS FAQSKYLENI REKTLTEVST SDIELLRRNS QPFRRATPCS LTVDLQANSF  60
TPKLQSYLMM MPGRNKRKER SWPEPQTQPQ SEIPSSSSSL AADNMSPPST IAYVLPPGFK  120
FMPNDKEVIN CYLKPYSDGN TNVLLNVPIH RVNIYESNPQ TLSGRNVATL TEDIGTQKWL  180
PKRFKAGDGV VGNKRPLAYY VGKPSEGVKT DWLMQEYSLD HSSHNTTR
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO184105260.0
Genevisible251694_s_at1e-176
Expression AtlasAT3G56560-
AtGenExpressAT3G56560-
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT3G56560.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT3G56560
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0026861e-171CP002686.1 Arabidopsis thaliana chromosome 3, complete sequence.
GenBankAL1639721e-171AL163972.1 Arabidopsis thaliana DNA chromosome 3, BAC clone T5P19.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_191215.11e-171NAC domain containing protein 65
TrEMBLQ9LXY41e-171Q9LXY4_ARATH; NAC domain containing protein 65
STRINGAT3G56560.11e-171(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM27931563
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Ooka H, et al.
    Comprehensive analysis of NAC family genes in Oryza sativa and Arabidopsis thaliana.
    DNA Res., 2003. 10(6): p. 239-47
    [PMID:15029955]