PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT3G56530.1
Common Nameanac064, NAC064, T5P19_180
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family NAC
Protein Properties Length: 319aa    MW: 36755.8 Da    PI: 5.4282
Description NAC domain containing protein 64
Gene Model
Gene Model ID Type Source Coding Sequence
AT3G56530.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM109.34.4e-34531802128
          NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleev.ikevdiykvePwdLp.kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkg 97 
                  ppG+rF P+d+el+ +yLk+  +g+k++l +v i++v+iy+++P++L  k  k+++k+w++ s+r k+ + g+ ++r+ + gyW+at   +++ + ++
  AT3G56530.1  53 PPGYRFVPKDQELIFHYLKPFSQGNKCSLLNVpIHRVNIYESNPQHLSeKYEKGNDKDWFYISERTKTGKAGRSNKRVDNGGYWSATVAAQKINA-GN 149
                  9****************************9999**************93444557779999999999999999999999***************9.99 PP

          NAM  98 elvglkktLvfykgrapkgektdWvmheyrl 128
                    vg k++L +y g++++++k dW+m+ey +
  AT3G56530.1 150 GIVGYKTSLEYYVGKQSNSVKGDWLMQEYWF 180
                  99***************************75 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.44E-4340201IPR003441NAC domain
PROSITE profilePS5100537.83552201IPR003441NAC domain
PfamPF023657.6E-1753178IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 319 aa     Download sequence    Send to blast
MAIPQRNKRK ARSSPERLTQ PPELPHNSDV PSSSSSSAAD NFFSWSTKQF AFPPGYRFVP  60
KDQELIFHYL KPFSQGNKCS LLNVPIHRVN IYESNPQHLS EKYEKGNDKD WFYISERTKT  120
GKAGRSNKRV DNGGYWSATV AAQKINAGNG IVGYKTSLEY YVGKQSNSVK GDWLMQEYWF  180
ESSDDNNNEK VDHALCKIYL TPAAAKKKKA EEAENEKLKK EEDVEQLDLN QPDQLQLQQP  240
HDIVYQPQYC LLPEHHQPQP FPDNFSELIS FQQQPVMIPD DFEDFLAEFT KPHSLDGDEE  300
FNNYGLFEGF FDTEGMIKH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A1e-214920717174NAC domain-containing protein 19
3swm_B1e-214920717174NAC domain-containing protein 19
3swm_C1e-214920717174NAC domain-containing protein 19
3swm_D1e-214920717174NAC domain-containing protein 19
3swp_A1e-214920717174NAC domain-containing protein 19
3swp_B1e-214920717174NAC domain-containing protein 19
3swp_C1e-214920717174NAC domain-containing protein 19
3swp_D1e-214920717174NAC domain-containing protein 19
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible249463_s_at6e-84
Expression AtlasAT3G56530-
AtGenExpressAT3G56530-
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT3G56530.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT3G56530
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB4936540.0AB493654.1 Arabidopsis thaliana At3g56530 mRNA for hypothetical protein, partial cds, clone: RAAt3g56530.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_191212.10.0NAC domain containing protein 64
TrEMBLQ9LXY70.0Q9LXY7_ARATH; NAC domain containing protein 64
STRINGAT3G56530.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM27931563
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Ooka H, et al.
    Comprehensive analysis of NAC family genes in Oryza sativa and Arabidopsis thaliana.
    DNA Res., 2003. 10(6): p. 239-47
    [PMID:15029955]