PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT3G55730.1
Common NameAtMYB109, F1I16_140, MYB109
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB
Protein Properties Length: 399aa    MW: 43536.6 Da    PI: 5.1888
Description myb domain protein 109
Gene Model
Gene Model ID Type Source Coding Sequence
AT3G55730.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.11e-1856101147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +g+W+teEd  l ++v++lG+++W++Iar ++ gR++k+c++rw + 
      AT3G55730.1  56 KGPWSTEEDAVLTKLVRKLGPRNWSLIARGIP-GRSGKSCRLRWCNQ 101
                      79******************************.***********985 PP

2Myb_DNA-binding47.44.4e-15108152147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      r++++ eEd  ++ a++ +G++ W+ Ia+ +  gRt++ +k++w++ 
      AT3G55730.1 108 RKPFSDEEDRMIISAHAVHGNK-WAVIAKLLT-GRTDNAIKNHWNST 152
                      789*******************.********9.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129425.26451106IPR017930Myb domain
SuperFamilySSF466893.49E-3053149IPR009057Homeodomain-like
SMARTSM007172.3E-1555104IPR001005SANT/Myb domain
PfamPF002494.4E-1756101IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.6E-2557109IPR009057Homeodomain-like
CDDcd001672.18E-1458100No hitNo description
PROSITE profilePS5129420.558107157IPR017930Myb domain
SMARTSM007174.9E-15107155IPR001005SANT/Myb domain
PfamPF002491.6E-13108152IPR001005SANT/Myb domain
CDDcd001673.65E-11110153No hitNo description
Gene3DG3DSA:1.10.10.606.5E-23110156IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0030154Biological Processcell differentiation
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0000981Molecular FunctionRNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001135Molecular Functiontranscription factor activity, RNA polymerase II transcription factor recruiting
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025195anatomypollen tube cell
PO:0025281anatomypollen
PO:0001016developmental stageL mature pollen stage
PO:0001017developmental stageM germinated pollen stage
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 399 aa     Download sequence    Send to blast
MEGETHQSEP LPLASGDSDE GISAAIEAEL AELAAGDSSG GGGCGGGGGG IRSKVKGPWS  60
TEEDAVLTKL VRKLGPRNWS LIARGIPGRS GKSCRLRWCN QLDPCLKRKP FSDEEDRMII  120
SAHAVHGNKW AVIAKLLTGR TDNAIKNHWN STLRRKYADL WNNGQWMANS VTTASVKNEN  180
VDETTNPPSS KQQLPQGDIN SSPPKPPQVS DVVMEEAANE PQEPQEQQEQ APPVVSNVPT  240
ENNVFRPVAR VGAFSIYNPT SQKNGYRDYN IVPCEGPLIQ AAKPDSLAGK FLQSLCDEPQ  300
IPSKCGHGCS TLPAETKFSR NSVLGPEFVD YEEPSAVFNQ ELISIATDLN NIAWIKSGLD  360
NAVVREAEQS LKMDNYNYND PRIKFTGMMP RQDFFCARS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C7e-39551563104C-Myb DNA-Binding Domain
1msf_C7e-39551563104C-Myb DNA-Binding Domain
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.17040.0flower| root
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible251763_at0.0
Expression AtlasAT3G55730-
AtGenExpressAT3G55730-
ATTED-IIAT3G55730-
Functional Description ? help Back to Top
Source Description
TAIRputative transcription factor MYB109 (MYB109) mRNA,
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT3G55730.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Regulation -- ATRM (Manually Curated Upstream Regulators) ? help Back to Top
Source Upstream Regulator (A: Activate/R: Repress)
ATRM AT5G07100 (R), AT5G47220 (A)
Regulation -- Hormone ? help Back to Top
Source Hormone
AHDabscisic acid, auxin, ethylene, gibberellin, jasmonic acid, salicylic acid
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT3G55730
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0000920.0BT000092.1 Arabidopsis thaliana MYB transcription factor-like protein (At3g55730) mRNA, complete cds.
GenBankAY1363250.0AY136325.1 Arabidopsis thaliana MYB transcription factor-like protein (At3g55730) mRNA, complete cds.
GenBankAF2627340.0AF262734.2 Arabidopsis thaliana putative transcription factor MYB109 (MYB109) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_191132.10.0myb domain protein 109
TrEMBLQ9LDW50.0Q9LDW5_ARATH; MYB transcription factor-like protein
STRINGAT3G55730.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
MalvidsOGEM56382747
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Stracke R,Werber M,Weisshaar B
    The R2R3-MYB gene family in Arabidopsis thaliana.
    Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56
    [PMID:11597504]
  3. Koroleva OA,Tomlinson ML,Leader D,Shaw P,Doonan JH
    High-throughput protein localization in Arabidopsis using Agrobacterium-mediated transient expression of GFP-ORF fusions.
    Plant J., 2005. 41(1): p. 162-74
    [PMID:15610358]
  4. Yanhui C, et al.
    The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family.
    Plant Mol. Biol., 2006. 60(1): p. 107-24
    [PMID:16463103]
  5. Maher C,Stein L,Ware D
    Evolution of Arabidopsis microRNA families through duplication events.
    Genome Res., 2006. 16(4): p. 510-9
    [PMID:16520461]
  6. Mandaokar A, et al.
    Transcriptional regulators of stamen development in Arabidopsis identified by transcriptional profiling.
    Plant J., 2006. 46(6): p. 984-1008
    [PMID:16805732]
  7. Dombrecht B, et al.
    MYC2 differentially modulates diverse jasmonate-dependent functions in Arabidopsis.
    Plant Cell, 2007. 19(7): p. 2225-45
    [PMID:17616737]
  8. Wang Y, et al.
    Transcriptome analyses show changes in gene expression to accompany pollen germination and tube growth in Arabidopsis.
    Plant Physiol., 2008. 148(3): p. 1201-11
    [PMID:18775970]
  9. Efroni I, et al.
    Regulation of leaf maturation by chromatin-mediated modulation of cytokinin responses.
    Dev. Cell, 2013. 24(4): p. 438-45
    [PMID:23449474]
  10. Jin J, et al.
    An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors.
    Mol. Biol. Evol., 2015. 32(7): p. 1767-73
    [PMID:25750178]