PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT3G55370.3
Common NameOBP3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family Dof
Protein Properties Length: 368aa    MW: 40726.4 Da    PI: 9.8015
Description OBF-binding protein 3
Gene Model
Gene Model ID Type Source Coding Sequence
AT3G55370.3genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof123.19.3e-39118177362
       zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                  e+al+cprCdstntkfCy+nnysl+qPr+fCk+CrryWt+GG+lrnvPvGgg r+nk+s+
  AT3G55370.3 118 EAALNCPRCDSTNTKFCYFNNYSLTQPRHFCKTCRRYWTRGGSLRNVPVGGGFRRNKRSK 177
                  6789*****************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074783.0E-38101173IPR003851Zinc finger, Dof-type
PfamPF027012.8E-32120175IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.161121175IPR003851Zinc finger, Dof-type
PROSITE patternPS013610123159IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009640Biological Processphotomorphogenesis
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
GO:0046872Molecular Functionmetal ion binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0009005anatomyroot
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009046anatomyflower
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007611developmental stagepetal differentiation and expansion stage
Sequence ? help Back to Top
Protein Sequence    Length: 368 aa     Download sequence    Send to blast
MVFSSLPVNQ FDSQNWQQMI SILVFFSTSR LFKKLFLVDK NLFSCLLQGL MYNVFLTGLI  60
FSLQGNQHQL ECVTTDQNPN NYLRQLSSPP TSQVAGSSQA RVNSMVERAR IAKVPLPEAA  120
LNCPRCDSTN TKFCYFNNYS LTQPRHFCKT CRRYWTRGGS LRNVPVGGGF RRNKRSKSRS  180
KSTVVVSTDN TTSTSSLTSR PSYSNPSKFH SYGQIPEFNS NLPILPPLQS LGDYNSSNTG  240
LDFGGTQISN MISGMSSSGG ILDAWRIPPS QQAQQFPFLI NTTGLVQSSN ALYPLLEGGV  300
SATQTRNVKA EENDQDRGRD GDGVNNLSRN FLGNININSG RNEEYTSWGG NSSWTGFTSN  360
NSTGHLSF
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible251806_at0.0
Expression AtlasAT3G55370-
AtGenExpressAT3G55370-
ATTED-IIAT3G55370-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Predominantly expressed in roots. {ECO:0000269|PubMed:10758484}.
Functional Description ? help Back to Top
Source Description
TAIREncodes a nuclear localized Dof domain containing transcription factor expressed primarily in roots. Responsive to salicylic acid. Transgenic overexpressors have yellow leaves and short, defective roots.
UniProtTranscription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. Enhances the DNA binding of OBF transcription factors to OCS elements. {ECO:0000269|PubMed:12887587}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00407DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT3G55370.3
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By auxin and salicylic acid (SA). Repressed by jasmonic acid (JA). {ECO:0000269|PubMed:10758484, ECO:0000269|PubMed:12887587}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top
Source Target Gene (A: Activate/R: Repress)
ATRM AT3G56970(A), AT3G56980(A), AT5G53450(A)
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT3G55370
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2214020.0AK221402.1 Arabidopsis thaliana mRNA for zinc finger protein OBP3, complete cds, clone: RAFL25-48-C17.
GenBankBT0330280.0BT033028.1 Arabidopsis thaliana unknown protein (At3g55370) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001190095.10.0OBF-binding protein 3
SwissprotQ9M2U10.0DOF36_ARATH; Dof zinc finger protein DOF3.6
TrEMBLF4IWU40.0F4IWU4_ARATH; OBF-binding protein 3
STRINGAT3G55370.30.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17132886
Representative plantOGRP3817445
Publications ? help Back to Top
  1. Kang HG,Singh KB
    Characterization of salicylic acid-responsive, arabidopsis Dof domain proteins: overexpression of OBP3 leads to growth defects.
    Plant J., 2000. 21(4): p. 329-39
    [PMID:10758484]
  2. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  3. Yanagisawa S
    The Dof family of plant transcription factors.
    Trends Plant Sci., 2002. 7(12): p. 555-60
    [PMID:12475498]
  4. Park DH, et al.
    The Arabidopsis COG1 gene encodes a Dof domain transcription factor and negatively regulates phytochrome signaling.
    Plant J., 2003. 34(2): p. 161-71
    [PMID:12694592]
  5. Lijavetzky D,Carbonero P,Vicente-Carbajosa J
    Genome-wide comparative phylogenetic analysis of the rice and Arabidopsis Dof gene families.
    BMC Evol. Biol., 2003. 3: p. 17
    [PMID:12877745]
  6. Kang HG,Foley RC,Oñate-Sánchez L,Lin C,Singh KB
    Target genes for OBP3, a Dof transcription factor, include novel basic helix-loop-helix domain proteins inducible by salicylic acid.
    Plant J., 2003. 35(3): p. 362-72
    [PMID:12887587]
  7. Ward JM,Cufr CA,Denzel MA,Neff MM
    The Dof transcription factor OBP3 modulates phytochrome and cryptochrome signaling in Arabidopsis.
    Plant Cell, 2005. 17(2): p. 475-85
    [PMID:15659636]
  8. Zhao C,Craig JC,Petzold HE,Dickerman AW,Beers EP
    The xylem and phloem transcriptomes from secondary tissues of the Arabidopsis root-hypocotyl.
    Plant Physiol., 2005. 138(2): p. 803-18
    [PMID:15923329]
  9. Shin R,Jez JM,Basra A,Zhang B,Schachtman DP
    14-3-3 proteins fine-tune plant nutrient metabolism.
    FEBS Lett., 2011. 585(1): p. 143-7
    [PMID:21094157]
  10. Brady SM, et al.
    A stele-enriched gene regulatory network in the Arabidopsis root.
    Mol. Syst. Biol., 2011. 7: p. 459
    [PMID:21245844]
  11. Gaudinier A, et al.
    Enhanced Y1H assays for Arabidopsis.
    Nat. Methods, 2011. 8(12): p. 1053-5
    [PMID:22037706]
  12. Jin J, et al.
    An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors.
    Mol. Biol. Evol., 2015. 32(7): p. 1767-73
    [PMID:25750178]