PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT3G55210.1
Common Nameanac063, NAC063, T26I12.90
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family NAC
Protein Properties Length: 280aa    MW: 31823.7 Da    PI: 6.1276
Description NAC domain containing protein 63
Gene Model
Gene Model ID Type Source Coding Sequence
AT3G55210.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM105.95.2e-33111501128
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleev.ikevdiykvePwdLpkkvka.eekewyfFskrdkkyatgkrknra...........tksgyWka 85 
                  lppGf+F P+dee++++yLk+  +g+++ l +v i+ v+iy+++P++L +++++ ++kew+  ++r+k  +  ++++r+           t+ gyW+a
  AT3G55210.1  11 LPPGFKFVPNDEEVIHCYLKPYSDGNTNVLLHVpIHLVNIYESNPQTLSEEFQKgNDKEWFIITERNKVDQGLSQTKRVgygakrqkrvdTNGGYWHA 108
                  79*************************9998989**************965544277899999999999986666666556666666666******** PP

          NAM  86 tgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                  t   +++ + ++ +v  k+ L++y g+ ++g+ktdW+m+ey+l
  AT3G55210.1 109 TVAAQKINA-GDGVVRNKRPLAYYVGKPSEGVKTDWLMQEYSL 150
                  ********9.9999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.1E-394169IPR003441NAC domain
PROSITE profilePS5100536.68311169IPR003441NAC domain
PfamPF023651.6E-1512150IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 280 aa     Download sequence    Send to blast
MSPPSTIAYV LPPGFKFVPN DEEVIHCYLK PYSDGNTNVL LHVPIHLVNI YESNPQTLSE  60
EFQKGNDKEW FIITERNKVD QGLSQTKRVG YGAKRQKRVD TNGGYWHATV AAQKINAGDG  120
VVRNKRPLAY YVGKPSEGVK TDWLMQEYSL DHSSHNNDKD YTLCKIYLTP QATKMNKEVG  180
EEKKKQKKGE AVVSVAPVEA LEEQLPCNVE YHQPLAPLDS CQPQPHDLAY QQQQFCPGPL  240
DSYQPQPHDM ENQQPHNEKL KKEEDVEQLD LHQPDQGKGC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A5e-181116717163NO APICAL MERISTEM PROTEIN
1ut4_B5e-181116717163NO APICAL MERISTEM PROTEIN
1ut7_A5e-181116717163NO APICAL MERISTEM PROTEIN
1ut7_B5e-181116717163NO APICAL MERISTEM PROTEIN
3swm_A5e-181116720166NAC domain-containing protein 19
3swm_B5e-181116720166NAC domain-containing protein 19
3swm_C5e-181116720166NAC domain-containing protein 19
3swm_D5e-181116720166NAC domain-containing protein 19
3swp_A5e-181116720166NAC domain-containing protein 19
3swp_B5e-181116720166NAC domain-containing protein 19
3swp_C5e-181116720166NAC domain-containing protein 19
3swp_D5e-181116720166NAC domain-containing protein 19
4dul_A5e-181116717163NAC domain-containing protein 19
4dul_B5e-181116717163NAC domain-containing protein 19
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO184102230.0
Genevisible251694_s_at2e-77
Expression AtlasAT3G55210-
AtGenExpressAT3G55210-
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT3G55210.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT3G55210
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB4936520.0AB493652.1 Arabidopsis thaliana At3g55210 mRNA for hypothetical protein, partial cds, clone: RAAt3g55210.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_191081.10.0NAC domain containing protein 63
TrEMBLQ9M3C90.0Q9M3C9_ARATH; NAC domain containing protein 63
STRINGAT3G55210.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM27931563
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Ooka H, et al.
    Comprehensive analysis of NAC family genes in Oryza sativa and Arabidopsis thaliana.
    DNA Res., 2003. 10(6): p. 239-47
    [PMID:15029955]
  3. Hanada K, et al.
    Functional compensation of primary and secondary metabolites by duplicate genes in Arabidopsis thaliana.
    Mol. Biol. Evol., 2011. 28(1): p. 377-82
    [PMID:20736450]