PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT3G54810.2
Common NameBME3, BME3-ZF, F28P10.210, GATA8, T5N23.3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family GATA
Protein Properties Length: 322aa    MW: 35628.6 Da    PI: 6.7104
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT3G54810.2genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA56.53.9e-18231264134
         GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                  C +C +tkTp+WR gp g+ktLCnaCG++y++ +
  AT3G54810.2 231 CMHCEVTKTPQWRLGPMGPKTLCNACGVRYKSGR 264
                  99*****************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169922.8E-981321IPR016679Transcription factor, GATA, plant
PROSITE profilePS5011411.569225261IPR000679Zinc finger, GATA-type
SMARTSM004017.8E-14225275IPR000679Zinc finger, GATA-type
SuperFamilySSF577161.52E-14229288No hitNo description
Gene3DG3DSA:3.30.50.102.8E-14229262IPR013088Zinc finger, NHR/GATA-type
CDDcd002029.38E-15230277No hitNo description
PROSITE patternPS003440231256IPR000679Zinc finger, GATA-type
PfamPF003204.1E-16231264IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
GO:0009845Biological Processseed germination
GO:0030154Biological Processcell differentiation
GO:0045944Biological Processpositive regulation of transcription from RNA polymerase II promoter
GO:0005634Cellular Componentnucleus
GO:0005667Cellular Componenttranscription factor complex
GO:0000977Molecular FunctionRNA polymerase II regulatory region sequence-specific DNA binding
GO:0001085Molecular FunctionRNA polymerase II transcription factor binding
GO:0001228Molecular Functiontranscriptional activator activity, RNA polymerase II transcription regulatory region sequence-specific binding
GO:0003682Molecular Functionchromatin binding
GO:0008270Molecular Functionzinc ion binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0009074anatomystyle
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 322 aa     Download sequence    Send to blast
MIGTSFPEDL DCGNFFDNMD DLMDFPGGDI DVGFGIGDSD SFPTIWTTHH DTWPAASDPL  60
FSSNTNSDSS PELYVPFEDI VKVERPPSFV EETLVEKKED SFSTNTDSSS SHSQFRSSSP  120
VSVLESSSSS SQTTNTTSLV LPGKHGRPRT KRPRPPVQDK DRVKDNVCGG DSRLIIRIPK  180
QFLSDHNKMI NKKKKKKAKI TSSSSSSGID LEVNGNNVDS YSSEQYPLRK CMHCEVTKTP  240
QWRLGPMGPK TLCNACGVRY KSGRLFPEYR PAASPTFTPA LHSNSHKKVA EMRNKRCSDG  300
SYITEENDLQ GLIPNNAYIG VD
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1150154KRPRP
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.239530.0flower| leaf| root| seed| vegetative tissue
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible251861_at0.0
Expression AtlasAT3G54810-
AtGenExpressAT3G54810-
ATTED-IIAT3G54810-
Functional Description ? help Back to Top
Source Description
TAIREncodes a protein containing a GATA type zinc finger domain that is expressed in the embryo axis and involved in germination. Mutants have a reduced rate of germination even when stratified.
UniProtTranscriptional activator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. May be involved in the regulation of some light-responsive genes (By similarity). {ECO:0000250}.
Function -- GeneRIF ? help Back to Top
  1. Blue Micropylar End 3 (BME3) is activated specifically in the embryonic axis and shows potential involvement in GA biosynthesis suggesting its role in the regulation of seed germination.
    [PMID: 16359389]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT3G54810.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT3G54810
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0780290.0AY078029.1 Arabidopsis thaliana AT3g54810/F28P10_210 mRNA, complete cds.
GenBankAK3175030.0AK317503.1 Arabidopsis thaliana AT3G54810 mRNA, complete cds, clone: RAFL23-14-K23.
GenBankAF4121070.0AF412107.1 Arabidopsis thaliana AT3g54810/F28P10_210 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_191041.10.0GATA transcription factor 8
RefseqNP_850704.10.0GATA transcription factor 8
SwissprotQ9SV300.0GATA8_ARATH; GATA transcription factor 8
TrEMBLB9DHF10.0B9DHF1_ARATH; AT3G54810 protein
STRINGAT3G54810.10.0(Arabidopsis thaliana)
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Gutierrez RA,Ewing RM,Cherry JM,Green PJ
    Identification of unstable transcripts in Arabidopsis by cDNA microarray analysis: rapid decay is associated with a group of touch- and specific clock-controlled genes.
    Proc. Natl. Acad. Sci. U.S.A., 2002. 99(17): p. 11513-8
    [PMID:12167669]
  3. Jeong MJ,Jeong MJ,Shih MC
    Interaction of a GATA factor with cis-acting elements involved in light regulation of nuclear genes encoding chloroplast glyceraldehyde-3-phosphate dehydrogenase in Arabidopsis.
    Biochem. Biophys. Res. Commun., 2003. 300(2): p. 555-62
    [PMID:12504119]
  4. Mittelsten Scheid O,Afsar K,Paszkowski J
    Formation of stable epialleles and their paramutation-like interaction in tetraploid Arabidopsis thaliana.
    Nat. Genet., 2003. 34(4): p. 450-4
    [PMID:12847525]
  5. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  6. Reyes JC,Muro-Pastor MI,Florencio FJ
    The GATA family of transcription factors in Arabidopsis and rice.
    Plant Physiol., 2004. 134(4): p. 1718-32
    [PMID:15084732]
  7. Guan Y,Nothnagel EA
    Binding of arabinogalactan proteins by Yariv phenylglycoside triggers wound-like responses in Arabidopsis cell cultures.
    Plant Physiol., 2004. 135(3): p. 1346-66
    [PMID:15235117]
  8. Lu Y,Zhu J,Liu P
    A two-step strategy for detecting differential gene expression in cDNA microarray data.
    Curr. Genet., 2005. 47(2): p. 121-31
    [PMID:15688252]
  9. Bi YM, et al.
    Genetic analysis of Arabidopsis GATA transcription factor gene family reveals a nitrate-inducible member important for chlorophyll synthesis and glucose sensitivity.
    Plant J., 2005. 44(4): p. 680-92
    [PMID:16262716]
  10. Liu PP,Koizuka N,Martin RC,Nonogaki H
    The BME3 (Blue Micropylar End 3) GATA zinc finger transcription factor is a positive regulator of Arabidopsis seed germination.
    Plant J., 2005. 44(6): p. 960-71
    [PMID:16359389]
  11. Manfield IW,Devlin PF,Jen CH,Westhead DR,Gilmartin PM
    Conservation, convergence, and divergence of light-responsive, circadian-regulated, and tissue-specific expression patterns during evolution of the Arabidopsis GATA gene family.
    Plant Physiol., 2007. 143(2): p. 941-58
    [PMID:17208962]
  12. Lee J, et al.
    Analysis of transcription factor HY5 genomic binding sites revealed its hierarchical role in light regulation of development.
    Plant Cell, 2007. 19(3): p. 731-49
    [PMID:17337630]
  13. Sottosanto JB,Saranga Y,Blumwald E
    Impact of AtNHX1, a vacuolar Na+/H+ antiporter, upon gene expression during short- and long-term salt stress in Arabidopsis thaliana.
    BMC Plant Biol., 2007. 7: p. 18
    [PMID:17411438]
  14. Goeres DC, et al.
    Components of the Arabidopsis mRNA decapping complex are required for early seedling development.
    Plant Cell, 2007. 19(5): p. 1549-64
    [PMID:17513503]