PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT3G54620.1
Common NameATBZIP25, BZIP25, BZO2H4, T14E10.190
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family bZIP
Protein Properties Length: 403aa    MW: 44330.7 Da    PI: 6.5963
Description basic leucine zipper 25
Gene Model
Gene Model ID Type Source Coding Sequence
AT3G54620.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_147.53.9e-15229283357
                  XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkeva 57 
                  ++kr+rr+ +NRe+ArrsR+RK++++ e  + v +L ae ++L+++l+ ++ +++
  AT3G54620.1 229 DVKRARRMLSNRESARRSRRRKQEQMNEFDTQVGQLRAEHSTLINRLSDMNHKYD 283
                  68******************************************77776666655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.3E-15227291IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1703.6E-10228281No hitNo description
PROSITE profilePS5021710.599229283IPR004827Basic-leucine zipper domain
PfamPF001702.6E-12230283IPR004827Basic-leucine zipper domain
SuperFamilySSF579594.5E-10231281No hitNo description
PROSITE patternPS000360234249IPR004827Basic-leucine zipper domain
PfamPF124983.1E-14298382IPR020983Basic leucine-zipper, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000693Biological Processpositive regulation of seed maturation
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0045735Molecular Functionnutrient reservoir activity
GO:0046982Molecular Functionprotein heterodimerization activity
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025195anatomypollen tube cell
PO:0025281anatomypollen
PO:0001016developmental stageL mature pollen stage
PO:0001017developmental stageM germinated pollen stage
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 403 aa     Download sequence    Send to blast
MHIVFSVDDL TESFWPVPAP APSPGSSSTP SPTQNVADGM TRSQSEWAFH RLINELSGSD  60
SSPTTNTIER SPPPVQSLSR LEETVDETED VVEIQKPQNH RRLPVDDQGK NRNRAPSSDP  120
VDSSAPVVVD PNQYHAILKS KLELACAAVA RRVGTVKPED SSASASNQKQ AQGSIVAQTS  180
PGASSVRFSP TTSTQKKPDV PARQTSISSR DDSDDDDLDG DADNGDPTDV KRARRMLSNR  240
ESARRSRRRK QEQMNEFDTQ VGQLRAEHST LINRLSDMNH KYDAAAVDNR ILRADIETLR  300
TKVKMAEETV KRVTGVNPLH WSRPNMGIPF SNTPSASSSI PPNSNHILKP ANSSTNTSAG  360
LAQNQRVETA NFLPEQVNRE GMQNPFAPDS NLYETLPHWN HKH
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1243250RRSRRRKQ
2245250SRRRKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.14680.0flower| inflorescence| leaf| root| silique| vegetative tissue
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible251848_at0.0
Expression AtlasAT3G54620-
AtGenExpressAT3G54620-
ATTED-IIAT3G54620-
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: First observed in seeds at early stages of development, mostly in embryo and, at lower extent, in the endosperm. Accumulates and peaks at maturation. Fade out during late seed development steps, restricted to the inner layer of the seed coat, and, at very low levels, in the mature embryo and the remaining endosperm. Also present in the lignified inner subepidermal layer of the valves. {ECO:0000269|PubMed:12657652, ECO:0000269|PubMed:18841482}.
UniprotTISSUE SPECIFICITY: Expressed in roots, shoots, stems, leaves, stipulae, siliques, seeds, pollen, and flowers. {ECO:0000269|PubMed:12657652, ECO:0000269|PubMed:18841482}.
Functional Description ? help Back to Top
Source Description
TAIRbZIP transcription factor-like protein mRNA
UniProtTranscription factor that binds to the 5'-ACGT-3' box, especially present in G-box-like motif (5'-CCACGTGGCC-3'), ABRE elements, of seed storage protein (SSP) encoding gene promoters (e.g. At2S and CRU3) and promotes their expression in seeds when in complex with ABI3 and BZIP53. {ECO:0000269|PubMed:12657652, ECO:0000269|PubMed:19261733, ECO:0000269|PubMed:19531597}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT3G54620.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top
Source Target Gene (A: Activate/R: Repress)
ATRM AT3G30775(A)
Interaction ? help Back to Top
Source Intact With
BioGRIDAT3G62420, AT4G02640, AT4G34590, AT5G49450, AT1G75390
IntActSearch Q9M1G6
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT3G54620
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0575090.0AY057509.1 Arabidopsis thaliana bZIP transcription factor-like protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_567003.20.0basic leucine zipper 25
SwissprotQ9M1G60.0BZP25_ARATH; Basic leucine zipper 25
TrEMBLA0A178V8640.0A0A178V864_ARATH; BZO2H4
STRINGAT3G54620.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM58482645
Representative plantOGRP18391639
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Jakoby M, et al.
    bZIP transcription factors in Arabidopsis.
    Trends Plant Sci., 2002. 7(3): p. 106-11
    [PMID:11906833]
  3. Vincentz M,Bandeira-Kobarg C,Gauer L,Schl
    Evolutionary pattern of angiosperm bZIP factors homologous to the maize Opaque2 regulatory protein.
    J. Mol. Evol., 2003. 56(1): p. 105-16
    [PMID:12569427]
  4. Lara P, et al.
    Synergistic activation of seed storage protein gene expression in Arabidopsis by ABI3 and two bZIPs related to OPAQUE2.
    J. Biol. Chem., 2003. 278(23): p. 21003-11
    [PMID:12657652]
  5. Dal Bosco C, et al.
    Inactivation of the chloroplast ATP synthase gamma subunit results in high non-photochemical fluorescence quenching and altered nuclear gene expression in Arabidopsis thaliana.
    J. Biol. Chem., 2004. 279(2): p. 1060-9
    [PMID:14576160]
  6. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  7. Satoh R,Fujita Y,Nakashima K,Shinozaki K,Yamaguchi-Shinozaki K
    A novel subgroup of bZIP proteins functions as transcriptional activators in hypoosmolarity-responsive expression of the ProDH gene in Arabidopsis.
    Plant Cell Physiol., 2004. 45(3): p. 309-17
    [PMID:15047879]
  8. Deppmann CD, et al.
    Dimerization specificity of all 67 B-ZIP motifs in Arabidopsis thaliana: a comparison to Homo sapiens B-ZIP motifs.
    Nucleic Acids Res., 2004. 32(11): p. 3435-45
    [PMID:15226410]
  9. Ehlert A, et al.
    Two-hybrid protein-protein interaction analysis in Arabidopsis protoplasts: establishment of a heterodimerization map of group C and group S bZIP transcription factors.
    Plant J., 2006. 46(5): p. 890-900
    [PMID:16709202]
  10. Deppmann CD,Alvania RS,Taparowsky EJ
    Cross-species annotation of basic leucine zipper factor interactions: Insight into the evolution of closed interaction networks.
    Mol. Biol. Evol., 2006. 23(8): p. 1480-92
    [PMID:16731568]
  11. Weltmeier F, et al.
    Combinatorial control of Arabidopsis proline dehydrogenase transcription by specific heterodimerisation of bZIP transcription factors.
    EMBO J., 2006. 25(13): p. 3133-43
    [PMID:16810321]
  12. Cheng C, et al.
    An early response regulatory cluster induced by low temperature and hydrogen peroxide in seedlings of chilling-tolerant japonica rice.
    BMC Genomics, 2007. 8: p. 175
    [PMID:17577400]
  13. Ascencio-Ib
    Global analysis of Arabidopsis gene expression uncovers a complex array of changes impacting pathogen response and cell cycle during geminivirus infection.
    Plant Physiol., 2008. 148(1): p. 436-54
    [PMID:18650403]
  14. Wang Y, et al.
    Transcriptome analyses show changes in gene expression to accompany pollen germination and tube growth in Arabidopsis.
    Plant Physiol., 2008. 148(3): p. 1201-11
    [PMID:18775970]
  15. Weltmeier F, et al.
    Expression patterns within the Arabidopsis C/S1 bZIP transcription factor network: availability of heterodimerization partners controls gene expression during stress response and development.
    Plant Mol. Biol., 2009. 69(1-2): p. 107-19
    [PMID:18841482]
  16. Jones AM, et al.
    Phosphoproteomic analysis of nuclei-enriched fractions from Arabidopsis thaliana.
    J Proteomics, 2009. 72(3): p. 439-51
    [PMID:19245862]
  17. Roschzttardtz H, et al.
    A nuclear gene encoding the iron-sulfur subunit of mitochondrial complex II is regulated by B3 domain transcription factors during seed development in Arabidopsis.
    Plant Physiol., 2009. 150(1): p. 84-95
    [PMID:19261733]
  18. Reiland S, et al.
    Large-scale Arabidopsis phosphoproteome profiling reveals novel chloroplast kinase substrates and phosphorylation networks.
    Plant Physiol., 2009. 150(2): p. 889-903
    [PMID:19376835]
  19. Alonso R, et al.
    A pivotal role of the basic leucine zipper transcription factor bZIP53 in the regulation of Arabidopsis seed maturation gene expression based on heterodimerization and protein complex formation.
    Plant Cell, 2009. 21(6): p. 1747-61
    [PMID:19531597]
  20. Kang SG,Price J,Lin PC,Hong JC,Jang JC
    The arabidopsis bZIP1 transcription factor is involved in sugar signaling, protein networking, and DNA binding.
    Mol Plant, 2010. 3(2): p. 361-73
    [PMID:20080816]
  21. Hanada K, et al.
    Functional compensation of primary and secondary metabolites by duplicate genes in Arabidopsis thaliana.
    Mol. Biol. Evol., 2011. 28(1): p. 377-82
    [PMID:20736450]
  22. Song QX, et al.
    Soybean GmbZIP123 gene enhances lipid content in the seeds of transgenic Arabidopsis plants.
    J. Exp. Bot., 2013. 64(14): p. 4329-41
    [PMID:23963672]
  23. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  24. Jin J, et al.
    An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors.
    Mol. Biol. Evol., 2015. 32(7): p. 1767-73
    [PMID:25750178]
  25. Ezer D, et al.
    The G-Box Transcriptional Regulatory Code in Arabidopsis.
    Plant Physiol., 2017. 175(2): p. 628-640
    [PMID:28864470]
  26. Jain P, et al.
    A-ZIP53, a dominant negative reveals the molecular mechanism of heterodimerization between bZIP53, bZIP10 and bZIP25 involved in Arabidopsis seed maturation.
    Sci Rep, 2017. 7(1): p. 14343
    [PMID:29084982]
  27. Pedrotti L, et al.
    Snf1-RELATED KINASE1-Controlled C/S1-bZIP Signaling Activates Alternative Mitochondrial Metabolic Pathways to Ensure Plant Survival in Extended Darkness.
    Plant Cell, 2018. 30(2): p. 495-509
    [PMID:29348240]