PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT3G52910.1
Common NameAtGRF4, F8J2_80, GRF4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family GRF
Protein Properties Length: 380aa    MW: 42533.7 Da    PI: 7.3746
Description growth-regulating factor 4
Gene Model
Gene Model ID Type Source Coding Sequence
AT3G52910.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC80.12.1e-25151195145
          WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                  d+epgrC+RtDGKkWRCsr+v++g+k+C+rH+hrgr+rsrk++e+
  AT3G52910.1 151 DPEPGRCKRTDGKKWRCSRDVVAGHKYCDRHIHRGRNRSRKPVET 195
                  79****************************************986 PP

2QLQ53.86e-1983117337
          QLQ   3 FTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37 
                  F++aQ+q+L+ Q+l+y+y++a++ vP+eLl++i+k
  AT3G52910.1  83 FSWAQWQELELQALIYRYMLAGASVPQELLLPIKK 117
                  *********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009518.6E-1281117IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166620.41282117IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088803.6E-1383115IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166725.479151195IPR014977WRC domain
PfamPF088791.7E-21152194IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048366Biological Processleaf development
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000293anatomyguard cell
PO:0009005anatomyroot
PO:0009046anatomyflower
PO:0020144anatomyapical meristem
Sequence ? help Back to Top
Protein Sequence    Length: 380 aa     Download sequence    Send to blast
MDLQLKQWRS QQQNESEEQG SAATKISNFF FDQIQSQTAT SAAAAPLPLF VPEPTSSSSF  60
SCFSPDSSNS SSSSRFLKMG NFFSWAQWQE LELQALIYRY MLAGASVPQE LLLPIKKSLL  120
HQSPMHFLHH PLQHSFPHHQ PSWYWGRGAM DPEPGRCKRT DGKKWRCSRD VVAGHKYCDR  180
HIHRGRNRSR KPVETATTTI TTTATTTASS FVLGEELGHG PNNNHFFSSG SSQPLHLSHQ  240
QSCSSEMKQE SNNNKRPYEA NSGFSNGRSD DGHILRHFFD DWPRSSDSTS SPMSSSTCHL  300
SISMPGNNTS SDVSLKLSTG NEEEEENMRN NNNEREQMNW WSNGGNHHNN MGGPLAEALR  360
SASSTSSVLH QMGISTQVFH
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.352480.0bud| root| seed
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1453394260.0
Genevisible252015_at4e-39
Expression AtlasAT3G52910-
AtGenExpressAT3G52910-
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed during the early stages of leaf development and expression decreases with the maturation of the leaf. {ECO:0000269|PubMed:20023165}.
UniprotTISSUE SPECIFICITY: Strongly expressed in actively growing and developing tissues, such as roots, upper stems, and shoot tips containing the shoot apical meristem (SAM) and flower buds. Also expressed in mature flowers, but weakly expressed in mature stems and leaves. {ECO:0000269|PubMed:12974814}.
Functional Description ? help Back to Top
Source Description
TAIRGrowth regulating factor encoding transcription activator. One of the nine members of a GRF gene family, containing nuclear targeting domain. Involved in leaf development and expressed in root, shoot and flower.
UniProtTranscription activator that plays a role in the regulation of cell expansion in leaf and cotyledons tissues. Component of a network formed by miR396, the GRFs and their interacting factors (GIFs) acting in the regulation of meristem function, at least partially through the control of cell proliferation. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT3G52910.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: microRNA 396 (miR396a or miR396b) negatively regulates growth-regulating factors (GRF1-4 and GRF7-9). {ECO:0000269|PubMed:15200956, ECO:0000269|PubMed:19453503, ECO:0000269|PubMed:20023165}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Interaction ? help Back to Top
Source Intact With
IntActSearch Q8L8A7
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT3G52910
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY1026370.0AY102637.1 Arabidopsis thaliana transcription activator (GRF4) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_190859.20.0growth-regulating factor 4
SwissprotQ8L8A70.0GRF4_ARATH; Growth-regulating factor 4
TrEMBLD7LUC30.0D7LUC3_ARALL; Putative uncharacterized protein
STRINGAT3G52910.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP9959611
MalvidsOGEM19262667
Publications ? help Back to Top
  1. Kim JH,Choi D,Kende H
    The AtGRF family of putative transcription factors is involved in leaf and cotyledon growth in Arabidopsis.
    Plant J., 2003. 36(1): p. 94-104
    [PMID:12974814]
  2. Jones-Rhoades MW,Bartel DP
    Computational identification of plant microRNAs and their targets, including a stress-induced miRNA.
    Mol. Cell, 2004. 14(6): p. 787-99
    [PMID:15200956]
  3. Kim JH,Kende H
    A transcriptional coactivator, AtGIF1, is involved in regulating leaf growth and morphology in Arabidopsis.
    Proc. Natl. Acad. Sci. U.S.A., 2004. 101(36): p. 13374-9
    [PMID:15326298]
  4. Davletova S, et al.
    Cytosolic ascorbate peroxidase 1 is a central component of the reactive oxygen gene network of Arabidopsis.
    Plant Cell, 2005. 17(1): p. 268-81
    [PMID:15608336]
  5. Horiguchi G,Kim GT,Tsukaya H
    The transcription factor AtGRF5 and the transcription coactivator AN3 regulate cell proliferation in leaf primordia of Arabidopsis thaliana.
    Plant J., 2005. 43(1): p. 68-78
    [PMID:15960617]
  6. Strader LC,Monroe-Augustus M,Rogers KC,Lin GL,Bartel B
    Arabidopsis iba response5 suppressors separate responses to various hormones.
    Genetics, 2008. 180(4): p. 2019-31
    [PMID:18832358]
  7. Liu D,Song Y,Chen Z,Yu D
    Ectopic expression of miR396 suppresses GRF target gene expression and alters leaf growth in Arabidopsis.
    Physiol Plant, 2009. 136(2): p. 223-36
    [PMID:19453503]
  8. Rodriguez RE, et al.
    Control of cell proliferation in Arabidopsis thaliana by microRNA miR396.
    Development, 2010. 137(1): p. 103-12
    [PMID:20023165]
  9. Arabidopsis Interactome Mapping Consortium
    Evidence for network evolution in an Arabidopsis interactome map.
    Science, 2011. 333(6042): p. 601-7
    [PMID:21798944]
  10. Liang G,He H,Li Y,Wang F,Yu D
    Molecular mechanism of microRNA396 mediating pistil development in Arabidopsis.
    Plant Physiol., 2014. 164(1): p. 249-58
    [PMID:24285851]