PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT3G52440.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family Dof
Protein Properties Length: 247aa    MW: 26935.7 Da    PI: 4.8921
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT3G52440.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof1183.6e-372581662
       zf-Dof  6 lkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                  +cprC s+ntkfCyynnysl+qPryfCk+CrryWtkGG+lrnvPvGgg+rk+++ +
  AT3G52440.1 25 PSCPRCGSSNTKFCYYNNYSLTQPRYFCKGCRRYWTKGGSLRNVPVGGGCRKSRRPK 81
                 58***************************************************9865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5088428.632579IPR003851Zinc finger, Dof-type
PfamPF027011.8E-312679IPR003851Zinc finger, Dof-type
PROSITE patternPS0136102763IPR003851Zinc finger, Dof-type
ProDomPD0074782.0E-252779IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046872Molecular Functionmetal ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 247 aa     Download sequence    Send to blast
MERAEALTSS FIWRPNANAN AEITPSCPRC GSSNTKFCYY NNYSLTQPRY FCKGCRRYWT  60
KGGSLRNVPV GGGCRKSRRP KSSSGNNTKT SLTANSGNPG GGSPSIDLAL VYANFLNPKP  120
DESILQENCD LATTDFLVDN PTGTSMDPSW SMDINDGHHD HYINPVEHIV EECGYNGLPP  180
FPGEELLSLD TNGVWSDALL IGHNHVDVGV TPVQAVHEPV VHFADESNDS TNLLFGSWSP  240
FDFTADG
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasAT3G52440
AtGenExpressAT3G52440
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00405DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT3G52440.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT3G52440
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAL0503000.0AL050300.2 Arabidopsis thaliana DNA chromosome 3, BAC clone F22O6.
GenBankCP0026860.0CP002686.1 Arabidopsis thaliana chromosome 3, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001327531.10.0Dof-type zinc finger DNA-binding family protein
RefseqNP_190812.10.0Dof-type zinc finger DNA-binding family protein
SwissprotQ9SVC50.0DOF35_ARATH; Dof zinc finger protein DOF3.5
TrEMBLA0A178VGL30.0A0A178VGL3_ARATH; Uncharacterized protein
TrEMBLC0SVE30.0C0SVE3_ARATH; Dof-type zinc finger DNA-binding family protein (Fragment)
STRINGAT3G52440.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM91412238
Representative plantOGRP3817445
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Yanagisawa S
    The Dof family of plant transcription factors.
    Trends Plant Sci., 2002. 7(12): p. 555-60
    [PMID:12475498]
  3. Lijavetzky D,Carbonero P,Vicente-Carbajosa J
    Genome-wide comparative phylogenetic analysis of the rice and Arabidopsis Dof gene families.
    BMC Evol. Biol., 2003. 3: p. 17
    [PMID:12877745]
  4. Kersten B, et al.
    Generation of Arabidopsis protein chips for antibody and serum screening.
    Plant Mol. Biol., 2003. 52(5): p. 999-1010
    [PMID:14558660]