PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT3G51080.1
Common NameF24M12.120, GATA6
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family GATA
Protein Properties Length: 312aa    MW: 34678.4 Da    PI: 7.5629
Description GATA transcription factor 6
Gene Model
Gene Model ID Type Source Coding Sequence
AT3G51080.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA57.12.5e-18223257135
         GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                  C +Cg+ kTp+WR gp g ktLCnaCG++y++ +l
  AT3G51080.1 223 CGHCGVQKTPQWRAGPLGAKTLCNACGVRYKSGRL 257
                  9******************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169926.3E-1081312IPR016679Transcription factor, GATA, plant
SuperFamilySSF577161.33E-13215278No hitNo description
SMARTSM004012.3E-14217271IPR000679Zinc finger, GATA-type
PROSITE profilePS5011411.688217253IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.104.3E-14221255IPR013088Zinc finger, NHR/GATA-type
CDDcd002025.26E-14222270No hitNo description
PfamPF003202.9E-16223257IPR000679Zinc finger, GATA-type
PROSITE patternPS003440223248IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009416Biological Processresponse to light stimulus
GO:0030154Biological Processcell differentiation
GO:0045944Biological Processpositive regulation of transcription from RNA polymerase II promoter
GO:0005634Cellular Componentnucleus
GO:0005667Cellular Componenttranscription factor complex
GO:0000977Molecular FunctionRNA polymerase II regulatory region sequence-specific DNA binding
GO:0001085Molecular FunctionRNA polymerase II transcription factor binding
GO:0001228Molecular Functiontranscriptional activator activity, RNA polymerase II transcription regulatory region sequence-specific binding
GO:0003682Molecular Functionchromatin binding
GO:0008270Molecular Functionzinc ion binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000293anatomyguard cell
Sequence ? help Back to Top
Protein Sequence    Length: 312 aa     Download sequence    Send to blast
MESVELTLKN SNMKDKTLTG GAQNGDDFSV DDLLDFSKEE EDDDVLVEDE AELKVQRKRG  60
VSDENTLHRS NDFSTADFHT SGLSVPMDDI AELEWLSNFV DDSSFTPYSA PTNKPVWLTG  120
NRRHLVQPVK EETCFKSQHP AVKTRPKRAR TGVRVWSHGS QSLTDSSSSS TTSSSSSPRP  180
SSPLWLASGQ FLDEPMTKTQ KKKKVWKNAG QTQTQTQTQT RQCGHCGVQK TPQWRAGPLG  240
AKTLCNACGV RYKSGRLLPE YRPACSPTFS SELHSNHHSK VIEMRRKKET SDGAEETGLN  300
QPVQTVQVVS SF
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.270880.0floral meristem| flower
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO425658190.0
Expression AtlasAT3G51080-
AtGenExpressAT3G51080-
Functional Description ? help Back to Top
Source Description
TAIREncodes a member of the GATA factor family of zinc finger transcription factors.
UniProtTranscriptional activator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. May be involved in the regulation of some light-responsive genes (By similarity). {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00404DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT3G51080.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT3G51080
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY1173150.0AY117315.1 Arabidopsis thaliana putative transcription factor (At3g51080) mRNA, complete cds.
GenBankAY0640480.0AY064048.1 Arabidopsis thaliana putative transcription factor (At3g51080) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_190677.10.0GATA transcription factor 6
SwissprotQ9SD380.0GATA6_ARATH; GATA transcription factor 6
TrEMBLD7LTM81e-143D7LTM8_ARALL; Putative uncharacterized protein
STRINGAT3G51080.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6817287
MalvidsOGEM36982561
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Jeong MJ,Jeong MJ,Shih MC
    Interaction of a GATA factor with cis-acting elements involved in light regulation of nuclear genes encoding chloroplast glyceraldehyde-3-phosphate dehydrogenase in Arabidopsis.
    Biochem. Biophys. Res. Commun., 2003. 300(2): p. 555-62
    [PMID:12504119]
  3. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  4. Reyes JC,Muro-Pastor MI,Florencio FJ
    The GATA family of transcription factors in Arabidopsis and rice.
    Plant Physiol., 2004. 134(4): p. 1718-32
    [PMID:15084732]
  5. Bi YM, et al.
    Genetic analysis of Arabidopsis GATA transcription factor gene family reveals a nitrate-inducible member important for chlorophyll synthesis and glucose sensitivity.
    Plant J., 2005. 44(4): p. 680-92
    [PMID:16262716]
  6. van de Mortel JE, et al.
    Large expression differences in genes for iron and zinc homeostasis, stress response, and lignin biosynthesis distinguish roots of Arabidopsis thaliana and the related metal hyperaccumulator Thlaspi caerulescens.
    Plant Physiol., 2006. 142(3): p. 1127-47
    [PMID:16998091]
  7. Manfield IW,Devlin PF,Jen CH,Westhead DR,Gilmartin PM
    Conservation, convergence, and divergence of light-responsive, circadian-regulated, and tissue-specific expression patterns during evolution of the Arabidopsis GATA gene family.
    Plant Physiol., 2007. 143(2): p. 941-58
    [PMID:17208962]