PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT3G50410.1
Common NameDOF3.4, F11C1_250, OBP1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family Dof
Protein Properties Length: 253aa    MW: 26382.2 Da    PI: 8.4938
Description OBF binding protein 1
Gene Model
Gene Model ID Type Source Coding Sequence
AT3G50410.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof122.51.5e-382686262
       zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                 ++++l+cprCds+ntkfCyynny+ sqPr+fCkaCrryWt+GG+lr+vPvGgg+rk+ k+s
  AT3G50410.1 26 QQEQLPCPRCDSSNTKFCYYNNYNFSQPRHFCKACRRYWTHGGTLRDVPVGGGTRKSAKRS 86
                 57899***************************************************98875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074784.0E-322384IPR003851Zinc finger, Dof-type
PfamPF027013.3E-332884IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.1433084IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103268IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009733Biological Processresponse to auxin
GO:0009751Biological Processresponse to salicylic acid
GO:0042545Biological Processcell wall modification
GO:0045787Biological Processpositive regulation of cell cycle
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005515Molecular Functionprotein binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
GO:0046872Molecular Functionmetal ion binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0005660anatomyhydathode
PO:0006339anatomyjuvenile vascular leaf
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020041anatomystipule
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0020147anatomyroot apical meristem
PO:0020148anatomyshoot apical meristem
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 253 aa     Download sequence    Send to blast
MPTSDSGEPR RIAMKPNGVT VPISDQQEQL PCPRCDSSNT KFCYYNNYNF SQPRHFCKAC  60
RRYWTHGGTL RDVPVGGGTR KSAKRSRTCS NSSSSSVSGV VSNSNGVPLQ TTPVLFPQSS  120
ISNGVTHTVT ESDGKGSALS LCGSFTSTLL NHNAAATATH GSGSVIGIGG FGIGLGSGFD  180
DVSFGLGRAM WPFSTVGTAT TTNVGSNGGH HAVPMPATWQ FEGLESNAGG GFVSGEYFAW  240
PDLSITTPGN SLK
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.207580.0seed
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1453393220.0
Genevisible252210_at0.0
Expression AtlasAT3G50410-
AtGenExpressAT3G50410-
ATTED-IIAT3G50410-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Constitutively expressed in the whole plant. {ECO:0000269|PubMed:10758484, ECO:0000269|PubMed:8718629}.
Functional Description ? help Back to Top
Source Description
TAIRArabidopsis Dof protein containing a single 51-amino acid zinc finger DNA-binding domain, which may play an important roles in plant growth and development.
UniProtTranscription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. Enhances the DNA binding of OBF transcription factors to OCS elements.
Function -- GeneRIF ? help Back to Top
  1. OBP1 controls cell cycle progression by targeting the expression of core cell cycle genes. Overexpression results in a shortening of the cell cycle.
    [PMID: 18665917]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00402DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT3G50410.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By auxin and salicylic acid (SA). {ECO:0000269|PubMed:10758484}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top
Source Target Gene (A: Activate/R: Repress)
ATRM AT1G49620(A), AT2G02820(A), AT2G47730(A)
Regulation -- Hormone ? help Back to Top
Source Hormone
AHDauxin, salicylic acid
Interaction ? help Back to Top
Source Intact With
BioGRIDAT5G10030
IntActSearch Q39088
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT3G50410
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0026860.0CP002686.1 Arabidopsis thaliana chromosome 3, complete sequence.
GenBankAL1329760.0AL132976.2 Arabidopsis thaliana DNA chromosome 3, BAC clone F11C1.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_190610.10.0Dof zinc finger protein DOF3.4
SwissprotQ390880.0DOF34_ARATH; Dof zinc finger protein DOF3.4
TrEMBLR0FTS81e-131R0FTS8_9BRAS; Uncharacterized protein
STRINGAT3G50410.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP3817445
MalvidsOGEM22862874
Publications ? help Back to Top
  1. Yanagisawa S,Schmidt RJ
    Diversity and similarity among recognition sequences of Dof transcription factors.
    Plant J., 1999. 17(2): p. 209-14
    [PMID:10074718]
  2. Kang HG,Singh KB
    Characterization of salicylic acid-responsive, arabidopsis Dof domain proteins: overexpression of OBP3 leads to growth defects.
    Plant J., 2000. 21(4): p. 329-39
    [PMID:10758484]
  3. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  4. Yanagisawa S
    The Dof family of plant transcription factors.
    Trends Plant Sci., 2002. 7(12): p. 555-60
    [PMID:12475498]
  5. Park DH, et al.
    The Arabidopsis COG1 gene encodes a Dof domain transcription factor and negatively regulates phytochrome signaling.
    Plant J., 2003. 34(2): p. 161-71
    [PMID:12694592]
  6. Lijavetzky D,Carbonero P,Vicente-Carbajosa J
    Genome-wide comparative phylogenetic analysis of the rice and Arabidopsis Dof gene families.
    BMC Evol. Biol., 2003. 3: p. 17
    [PMID:12877745]
  7. Kersten B, et al.
    Generation of Arabidopsis protein chips for antibody and serum screening.
    Plant Mol. Biol., 2003. 52(5): p. 999-1010
    [PMID:14558660]
  8. Rodriguez Milla MA,Maurer A,Rodriguez Huete A,Gustafson JP
    Glutathione peroxidase genes in Arabidopsis are ubiquitous and regulated by abiotic stresses through diverse signaling pathways.
    Plant J., 2003. 36(5): p. 602-15
    [PMID:14617062]
  9. Ikeda Y,Banno H,Niu QW,Howell SH,Chua NH
    The ENHANCER OF SHOOT REGENERATION 2 gene in Arabidopsis regulates CUP-SHAPED COTYLEDON 1 at the transcriptional level and controls cotyledon development.
    Plant Cell Physiol., 2006. 47(11): p. 1443-56
    [PMID:17056621]
  10. Chawade A,Br
    Putative cold acclimation pathways in Arabidopsis thaliana identified by a combined analysis of mRNA co-expression patterns, promoter motifs and transcription factors.
    BMC Genomics, 2007. 8: p. 304
    [PMID:17764576]
  11. Song YH, et al.
    Isolation of CONSTANS as a TGA4/OBF4 interacting protein.
    Mol. Cells, 2008. 25(4): p. 559-65
    [PMID:18587275]
  12. Skirycz A, et al.
    The DOF transcription factor OBP1 is involved in cell cycle regulation in Arabidopsis thaliana.
    Plant J., 2008. 56(5): p. 779-92
    [PMID:18665917]
  13. Vandepoele K,Quimbaya M,Casneuf T,De Veylder L,Van de Peer Y
    Unraveling transcriptional control in Arabidopsis using cis-regulatory elements and coexpression networks.
    Plant Physiol., 2009. 150(2): p. 535-46
    [PMID:19357200]
  14. Hanada K, et al.
    Functional compensation of primary and secondary metabolites by duplicate genes in Arabidopsis thaliana.
    Mol. Biol. Evol., 2011. 28(1): p. 377-82
    [PMID:20736450]
  15. Gaudinier A, et al.
    Enhanced Y1H assays for Arabidopsis.
    Nat. Methods, 2011. 8(12): p. 1053-5
    [PMID:22037706]
  16. Jin J, et al.
    An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors.
    Mol. Biol. Evol., 2015. 32(7): p. 1767-73
    [PMID:25750178]
  17. Zhang B,Chen W,Foley RC,B├╝ttner M,Singh KB
    Interactions between distinct types of DNA binding proteins enhance binding to ocs element promoter sequences.
    Plant Cell, 1995. 7(12): p. 2241-52
    [PMID:8718629]
  18. Chen W,Chao G,Singh KB
    The promoter of a H2O2-inducible, Arabidopsis glutathione S-transferase gene contains closely linked OBF- and OBP1-binding sites.
    Plant J., 1996. 10(6): p. 955-66
    [PMID:9011080]
  19. Vicente-Carbajosa J,Moose SP,Parsons RL,Schmidt RJ
    A maize zinc-finger protein binds the prolamin box in zein gene promoters and interacts with the basic leucine zipper transcriptional activator Opaque2.
    Proc. Natl. Acad. Sci. U.S.A., 1997. 94(14): p. 7685-90
    [PMID:9207153]